[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_00708


[Show Plain Result]

## Summary of Sequence Search
   1::693
  91::131  1.4e-09 46.3% 0036289 00362891 1/1   ys6 DNA-binding domain                  
  84::126  4.6e-09 44.2% 0035235 00352351 1/1   ys6 DNA-binding domain                  
  90::131  9.3e-09 50.0% 0042516 00425161 1/1   ys6 DNA-binding domain                  
  85::127    4e-08 44.2% 0045307 00453071 1/1   ys6 DNA-binding domain                  
  81::135  4.9e-08 34.5% 0045159 00451591 1/1   ys6 DNA-binding domain                  
  92::124  3.5e-06 51.5% 0046168 00461681 1/1   ys6 DNA-binding domain                  
  91::127  5.5e-06 47.2% 0045125 00451251 1/1   ys6 DNA-binding domain                  
   1::693


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSSTVGGHLLPQNDFDIPLNLAASPSVSAIPDYSGNGGAYQIAAKLDSNPSQNATVKQQSAVGSTVAGAA
00362891   1/1  ----------------------------------------------------------------------
00352351   1/1  ----------------------------------------------------------------------
00425161   1/1  ----------------------------------------------------------------------
00453071   1/1  ----------------------------------------------------------------------
00451591   1/1  ----------------------------------------------------------------------
00461681   1/1  ----------------------------------------------------------------------
00451251   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AAGRGAGPATRPDAPKSKRVRTGCLTCRERHLKCDETLPRCQNCQKSDRLCKRGVRLNFIDTQVAAPPYA
00362891   1/1  --------------------rlaCltCrkrkvkCdeelPlCsnClklgleClyllelllll---------
00352351   1/1  -------------lkkrkrlllaCllCrkrklkCdeelPlCsrClklgleClylle--------------
00425161   1/1  -------------------vrlaCltCrkrklkCdeelPlCsnClklgleClyldllllll---------
00453071   1/1  --------------lkrkrlllaCllCrkrklkCdeelPlCsrClklgleclylllp-------------
00451591   1/1  ----------lllkkkrrrvrlaCllCrkrkvkCdgalpldllsldslllCsrClklgleCvysl-----
00461681   1/1  ---------------------laCllCrkrklkCdeelPlCsnClklgleCvye----------------
00451251   1/1  --------------------llaCllCrrrklkCdgelP.CsnClklgleclyllel-------------


                         +         -         -         -         -         *         -:210
query           VPSSHDWQVNFHDESREIASEYLGGYERYPSLKKETPSRRAGPVYAYRETQAMATPHPGPTSASLLTPFA
00362891   1/1  ----------------------------------------------------------------------
00352351   1/1  ----------------------------------------------------------------------
00425161   1/1  ----------------------------------------------------------------------
00453071   1/1  ----------------------------------------------------------------------
00451591   1/1  ----------------------------------------------------------------------
00461681   1/1  ----------------------------------------------------------------------
00451251   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EHPQPDITAEPIFHGTPQAPAPDSAYTEHAMARSPFDAPKHPLAPANELRPYLNTAEEVLLMQVYVEEVG
00362891   1/1  ----------------------------------------------------------------------
00352351   1/1  ----------------------------------------------------------------------
00425161   1/1  ----------------------------------------------------------------------
00453071   1/1  ----------------------------------------------------------------------
00451591   1/1  ----------------------------------------------------------------------
00461681   1/1  ----------------------------------------------------------------------
00451251   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LWMDSMDPGKHVFNPSFGEEKALYYYNISTRDLLTCLQDPNRDTVLCATTAVVLNVYEVMCEKAMQRMNH
00362891   1/1  ----------------------------------------------------------------------
00352351   1/1  ----------------------------------------------------------------------
00425161   1/1  ----------------------------------------------------------------------
00453071   1/1  ----------------------------------------------------------------------
00451591   1/1  ----------------------------------------------------------------------
00461681   1/1  ----------------------------------------------------------------------
00451251   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           IAGARALIKECRWNAKTTGIGGACFWLNVGMELLSCLHFNWKMAWDPDTWDIDMNMSLNQGSIAGDEEFW
00362891   1/1  ----------------------------------------------------------------------
00352351   1/1  ----------------------------------------------------------------------
00425161   1/1  ----------------------------------------------------------------------
00453071   1/1  ----------------------------------------------------------------------
00451591   1/1  ----------------------------------------------------------------------
00461681   1/1  ----------------------------------------------------------------------
00451251   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           THRMLYICAKIANYRATMAYQGLDRSSHDPRLNQRCEEWNALRAWCDEWARCAPRSMMPLGYLHPWETNS
00362891   1/1  ----------------------------------------------------------------------
00352351   1/1  ----------------------------------------------------------------------
00425161   1/1  ----------------------------------------------------------------------
00453071   1/1  ----------------------------------------------------------------------
00451591   1/1  ----------------------------------------------------------------------
00461681   1/1  ----------------------------------------------------------------------
00451251   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           KSSFPEVWLIKRSAVVGRLFYHTACCLLAKVHPTESEYSDEMLSMQHSHAHDICGIVAHVKDRGVASVSI
00362891   1/1  ----------------------------------------------------------------------
00352351   1/1  ----------------------------------------------------------------------
00425161   1/1  ----------------------------------------------------------------------
00453071   1/1  ----------------------------------------------------------------------
00451591   1/1  ----------------------------------------------------------------------
00461681   1/1  ----------------------------------------------------------------------
00451251   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           RCLAIAAECVVGREAQEEVIAILDKIIKETGWQVGFLQHELIEKWGWNSATSHMSPHQSQHPQMAAAGPS
00362891   1/1  ----------------------------------------------------------------------
00352351   1/1  ----------------------------------------------------------------------
00425161   1/1  ----------------------------------------------------------------------
00453071   1/1  ----------------------------------------------------------------------
00451591   1/1  ----------------------------------------------------------------------
00461681   1/1  ----------------------------------------------------------------------
00451251   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           TDLGSSLLNSALPSAPPSRPRMPQGIVNPLMATADFSFDNHPYQNHYVAPHNNHLNNYHYGSY-------
00362891   1/1  ----------------------------------------------------------------------
00352351   1/1  ----------------------------------------------------------------------
00425161   1/1  ----------------------------------------------------------------------
00453071   1/1  ----------------------------------------------------------------------
00451591   1/1  ----------------------------------------------------------------------
00461681   1/1  ----------------------------------------------------------------------
00451251   1/1  ----------------------------------------------------------------------