[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_00735


[Show Plain Result]

## Summary of Sequence Search
   1::505
 364::437  9.4e-07 21.6% 0049867 00498671 1/1   omain                                   
 394::442    4e-06 29.2% 0041374 00413741 1/1   omain                                   
 377::448  1.7e-05 26.4% 0038838 00388381 1/1   omain                                   
 381::442    2e-05 25.8% 0050583 00505831 1/1   omain                                   
 371::487  2.1e-05 24.8% 0044915 00449151 1/1   omain                                   
 388::435  6.4e-05 27.1% 0049926 00499261 1/1   omain                                   
 394::442  7.9e-05 32.7% 0042705 00427051 1/1   omain                                   
 395::436  8.9e-05 33.3% 0042323 00423231 1/1   omain                                   
 380::437   0.0001 27.6% 0047724 00477241 1/1   omain                                   
 389::437  0.00011 28.6% 0046957 00469571 1/1   omain                                   
 391::447  0.00011 28.1% 0049871 00498711 1/1   omain                                   
 386::450  0.00012 27.7% 0045920 00459201 1/1   omain                                   
 389::437  0.00012 30.6% 0042039 00420391 1/1   omain                                   
 396::442  0.00012 38.3% 0047008 00470081 1/1   omain                                   
 391::439  0.00013 26.5% 0050508 00505081 1/1   omain                                   
 396::445  0.00013 28.0% 0037667 00376671 1/1   omain                                   
 397::440  0.00013 34.1% 0047819 00478191 1/1   omain                                   
 377::435  0.00016 23.7% 0046906 00469061 1/1   omain                                   
 395::440  0.00016 34.9% 0045813 00458131 1/1   omain                                   
 398::445  0.00017 33.3% 0047642 00476421 1/1   omain                                   
 396::437  0.00018 35.7% 0049376 00493761 1/1   omain                                   
 378::439  0.00019 19.4% 0049175 00491751 1/1   omain                                   
 396::437  0.00022 33.3% 0047043 00470431 1/1   omain                                   
 390::442  0.00023 34.0% 0045835 00458351 1/1   omain                                   
 370::441  0.00024 23.6% 0043854 00438541 1/1   omain                                   
 397::442  0.00024 39.5% 0036029 00360291 1/1   omain                                   
 378::442  0.00028 26.2% 0045834 00458341 1/1   omain                                   
 397::437  0.00028 36.6% 0050000 00500001 1/1   omain                                   
 384::442  0.00031 28.8% 0047663 00476631 1/1   omain                                   
 393::435  0.00034 35.0% 0049882 00498821 1/1   omain                                   
 392::437  0.00036 30.2% 0047233 00472331 1/1   omain                                   
 393::437  0.00036 33.3% 0047748 00477481 1/1   omain                                   
 393::437  0.00036 35.7% 0048550 00485501 1/1   omain                                   
 392::442  0.00042 31.4% 0047765 00477651 1/1   omain                                   
 394::437  0.00045 34.1% 0045082 00450821 1/1   omain                                   
 400::435  0.00045 41.7% 0038478 00384781 1/1   omain                                   
 397::437  0.00046 34.1% 0041338 00413381 1/1   omain                                   
 397::445  0.00051 32.7% 0043613 00436131 1/1   omain                                   
 391::437  0.00058 27.7% 0049439 00494391 1/1   omain                                   
 395::437  0.00069 34.9% 0036794 00367941 1/1   omain                                   
 388::435  0.00073 27.1% 0049900 00499001 1/1   omain                                   
 390::437  0.00073 29.8% 0049905 00499051 1/1   omain                                   
 395::437  0.00076 34.9% 0052588 00525881 1/1   omain                                   
 399::435  0.00096 37.8% 0036795 00367951 1/1   omain                                   
   1::505


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAGYGTIQGKFLRPFLELVSSVKDFDKELQNYVHHDYVKRKYQDLLGCSNVKLTNTSSLYARYTTSVICN
00498671   1/1  ----------------------------------------------------------------------
00413741   1/1  ----------------------------------------------------------------------
00388381   1/1  ----------------------------------------------------------------------
00505831   1/1  ----------------------------------------------------------------------
00449151   1/1  ----------------------------------------------------------------------
00499261   1/1  ----------------------------------------------------------------------
00427051   1/1  ----------------------------------------------------------------------
00423231   1/1  ----------------------------------------------------------------------
00477241   1/1  ----------------------------------------------------------------------
00469571   1/1  ----------------------------------------------------------------------
00498711   1/1  ----------------------------------------------------------------------
00459201   1/1  ----------------------------------------------------------------------
00420391   1/1  ----------------------------------------------------------------------
00470081   1/1  ----------------------------------------------------------------------
00505081   1/1  ----------------------------------------------------------------------
00376671   1/1  ----------------------------------------------------------------------
00478191   1/1  ----------------------------------------------------------------------
00469061   1/1  ----------------------------------------------------------------------
00458131   1/1  ----------------------------------------------------------------------
00476421   1/1  ----------------------------------------------------------------------
00493761   1/1  ----------------------------------------------------------------------
00491751   1/1  ----------------------------------------------------------------------
00470431   1/1  ----------------------------------------------------------------------
00458351   1/1  ----------------------------------------------------------------------
00438541   1/1  ----------------------------------------------------------------------
00360291   1/1  ----------------------------------------------------------------------
00458341   1/1  ----------------------------------------------------------------------
00500001   1/1  ----------------------------------------------------------------------
00476631   1/1  ----------------------------------------------------------------------
00498821   1/1  ----------------------------------------------------------------------
00472331   1/1  ----------------------------------------------------------------------
00477481   1/1  ----------------------------------------------------------------------
00485501   1/1  ----------------------------------------------------------------------
00477651   1/1  ----------------------------------------------------------------------
00450821   1/1  ----------------------------------------------------------------------
00384781   1/1  ----------------------------------------------------------------------
00413381   1/1  ----------------------------------------------------------------------
00436131   1/1  ----------------------------------------------------------------------
00494391   1/1  ----------------------------------------------------------------------
00367941   1/1  ----------------------------------------------------------------------
00499001   1/1  ----------------------------------------------------------------------
00499051   1/1  ----------------------------------------------------------------------
00525881   1/1  ----------------------------------------------------------------------
00367951   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GIVQSSREICNVSPDDSRPLCADTCALSATSEELVAVNPDLCGTPKSNFMDQIRSDFTICANPADSLTGK
00498671   1/1  ----------------------------------------------------------------------
00413741   1/1  ----------------------------------------------------------------------
00388381   1/1  ----------------------------------------------------------------------
00505831   1/1  ----------------------------------------------------------------------
00449151   1/1  ----------------------------------------------------------------------
00499261   1/1  ----------------------------------------------------------------------
00427051   1/1  ----------------------------------------------------------------------
00423231   1/1  ----------------------------------------------------------------------
00477241   1/1  ----------------------------------------------------------------------
00469571   1/1  ----------------------------------------------------------------------
00498711   1/1  ----------------------------------------------------------------------
00459201   1/1  ----------------------------------------------------------------------
00420391   1/1  ----------------------------------------------------------------------
00470081   1/1  ----------------------------------------------------------------------
00505081   1/1  ----------------------------------------------------------------------
00376671   1/1  ----------------------------------------------------------------------
00478191   1/1  ----------------------------------------------------------------------
00469061   1/1  ----------------------------------------------------------------------
00458131   1/1  ----------------------------------------------------------------------
00476421   1/1  ----------------------------------------------------------------------
00493761   1/1  ----------------------------------------------------------------------
00491751   1/1  ----------------------------------------------------------------------
00470431   1/1  ----------------------------------------------------------------------
00458351   1/1  ----------------------------------------------------------------------
00438541   1/1  ----------------------------------------------------------------------
00360291   1/1  ----------------------------------------------------------------------
00458341   1/1  ----------------------------------------------------------------------
00500001   1/1  ----------------------------------------------------------------------
00476631   1/1  ----------------------------------------------------------------------
00498821   1/1  ----------------------------------------------------------------------
00472331   1/1  ----------------------------------------------------------------------
00477481   1/1  ----------------------------------------------------------------------
00485501   1/1  ----------------------------------------------------------------------
00477651   1/1  ----------------------------------------------------------------------
00450821   1/1  ----------------------------------------------------------------------
00384781   1/1  ----------------------------------------------------------------------
00413381   1/1  ----------------------------------------------------------------------
00436131   1/1  ----------------------------------------------------------------------
00494391   1/1  ----------------------------------------------------------------------
00367941   1/1  ----------------------------------------------------------------------
00499001   1/1  ----------------------------------------------------------------------
00499051   1/1  ----------------------------------------------------------------------
00525881   1/1  ----------------------------------------------------------------------
00367951   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           CISGSENEPAECGYGPNLLGLCGFCAESSPNATDSCCVAADATNRCRGLELPTVPSLPPLFPSSTSSSNP
00498671   1/1  ----------------------------------------------------------------------
00413741   1/1  ----------------------------------------------------------------------
00388381   1/1  ----------------------------------------------------------------------
00505831   1/1  ----------------------------------------------------------------------
00449151   1/1  ----------------------------------------------------------------------
00499261   1/1  ----------------------------------------------------------------------
00427051   1/1  ----------------------------------------------------------------------
00423231   1/1  ----------------------------------------------------------------------
00477241   1/1  ----------------------------------------------------------------------
00469571   1/1  ----------------------------------------------------------------------
00498711   1/1  ----------------------------------------------------------------------
00459201   1/1  ----------------------------------------------------------------------
00420391   1/1  ----------------------------------------------------------------------
00470081   1/1  ----------------------------------------------------------------------
00505081   1/1  ----------------------------------------------------------------------
00376671   1/1  ----------------------------------------------------------------------
00478191   1/1  ----------------------------------------------------------------------
00469061   1/1  ----------------------------------------------------------------------
00458131   1/1  ----------------------------------------------------------------------
00476421   1/1  ----------------------------------------------------------------------
00493761   1/1  ----------------------------------------------------------------------
00491751   1/1  ----------------------------------------------------------------------
00470431   1/1  ----------------------------------------------------------------------
00458351   1/1  ----------------------------------------------------------------------
00438541   1/1  ----------------------------------------------------------------------
00360291   1/1  ----------------------------------------------------------------------
00458341   1/1  ----------------------------------------------------------------------
00500001   1/1  ----------------------------------------------------------------------
00476631   1/1  ----------------------------------------------------------------------
00498821   1/1  ----------------------------------------------------------------------
00472331   1/1  ----------------------------------------------------------------------
00477481   1/1  ----------------------------------------------------------------------
00485501   1/1  ----------------------------------------------------------------------
00477651   1/1  ----------------------------------------------------------------------
00450821   1/1  ----------------------------------------------------------------------
00384781   1/1  ----------------------------------------------------------------------
00413381   1/1  ----------------------------------------------------------------------
00436131   1/1  ----------------------------------------------------------------------
00494391   1/1  ----------------------------------------------------------------------
00367941   1/1  ----------------------------------------------------------------------
00499001   1/1  ----------------------------------------------------------------------
00499051   1/1  ----------------------------------------------------------------------
00525881   1/1  ----------------------------------------------------------------------
00367951   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           SASAGAGTGLSGGTIAGIVVGSVAGIALLGALAVFLFIFLRRRRDRNSSIFNQPSPPRKGTSSMQYAPGN
00498671   1/1  ----------------------------------------------------------------------
00413741   1/1  ----------------------------------------------------------------------
00388381   1/1  ----------------------------------------------------------------------
00505831   1/1  ----------------------------------------------------------------------
00449151   1/1  ----------------------------------------------------------------------
00499261   1/1  ----------------------------------------------------------------------
00427051   1/1  ----------------------------------------------------------------------
00423231   1/1  ----------------------------------------------------------------------
00477241   1/1  ----------------------------------------------------------------------
00469571   1/1  ----------------------------------------------------------------------
00498711   1/1  ----------------------------------------------------------------------
00459201   1/1  ----------------------------------------------------------------------
00420391   1/1  ----------------------------------------------------------------------
00470081   1/1  ----------------------------------------------------------------------
00505081   1/1  ----------------------------------------------------------------------
00376671   1/1  ----------------------------------------------------------------------
00478191   1/1  ----------------------------------------------------------------------
00469061   1/1  ----------------------------------------------------------------------
00458131   1/1  ----------------------------------------------------------------------
00476421   1/1  ----------------------------------------------------------------------
00493761   1/1  ----------------------------------------------------------------------
00491751   1/1  ----------------------------------------------------------------------
00470431   1/1  ----------------------------------------------------------------------
00458351   1/1  ----------------------------------------------------------------------
00438541   1/1  ----------------------------------------------------------------------
00360291   1/1  ----------------------------------------------------------------------
00458341   1/1  ----------------------------------------------------------------------
00500001   1/1  ----------------------------------------------------------------------
00476631   1/1  ----------------------------------------------------------------------
00498821   1/1  ----------------------------------------------------------------------
00472331   1/1  ----------------------------------------------------------------------
00477481   1/1  ----------------------------------------------------------------------
00485501   1/1  ----------------------------------------------------------------------
00477651   1/1  ----------------------------------------------------------------------
00450821   1/1  ----------------------------------------------------------------------
00384781   1/1  ----------------------------------------------------------------------
00413381   1/1  ----------------------------------------------------------------------
00436131   1/1  ----------------------------------------------------------------------
00494391   1/1  ----------------------------------------------------------------------
00367941   1/1  ----------------------------------------------------------------------
00499001   1/1  ----------------------------------------------------------------------
00499051   1/1  ----------------------------------------------------------------------
00525881   1/1  ----------------------------------------------------------------------
00367951   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           MAQGHGFDVLPGGRVARMSALQNNDDSPRGTAAMKYDSSDSEAFASPASGTRRRPPVTGRRNGSLSSASA
00498671   1/1  ----------------------------------------------------------------------
00413741   1/1  ----------------------------------------------------------------------
00388381   1/1  ----------------------------------------------------------------------
00505831   1/1  ----------------------------------------------------------------------
00449151   1/1  ----------------------------------------------------------------------
00499261   1/1  ----------------------------------------------------------------------
00427051   1/1  ----------------------------------------------------------------------
00423231   1/1  ----------------------------------------------------------------------
00477241   1/1  ----------------------------------------------------------------------
00469571   1/1  ----------------------------------------------------------------------
00498711   1/1  ----------------------------------------------------------------------
00459201   1/1  ----------------------------------------------------------------------
00420391   1/1  ----------------------------------------------------------------------
00470081   1/1  ----------------------------------------------------------------------
00505081   1/1  ----------------------------------------------------------------------
00376671   1/1  ----------------------------------------------------------------------
00478191   1/1  ----------------------------------------------------------------------
00469061   1/1  ----------------------------------------------------------------------
00458131   1/1  ----------------------------------------------------------------------
00476421   1/1  ----------------------------------------------------------------------
00493761   1/1  ----------------------------------------------------------------------
00491751   1/1  ----------------------------------------------------------------------
00470431   1/1  ----------------------------------------------------------------------
00458351   1/1  ----------------------------------------------------------------------
00438541   1/1  ----------------------------------------------------------------------
00360291   1/1  ----------------------------------------------------------------------
00458341   1/1  ----------------------------------------------------------------------
00500001   1/1  ----------------------------------------------------------------------
00476631   1/1  ----------------------------------------------------------------------
00498821   1/1  ----------------------------------------------------------------------
00472331   1/1  ----------------------------------------------------------------------
00477481   1/1  ----------------------------------------------------------------------
00485501   1/1  ----------------------------------------------------------------------
00477651   1/1  ----------------------------------------------------------------------
00450821   1/1  ----------------------------------------------------------------------
00384781   1/1  ----------------------------------------------------------------------
00413381   1/1  ----------------------------------------------------------------------
00436131   1/1  ----------------------------------------------------------------------
00494391   1/1  ----------------------------------------------------------------------
00367941   1/1  ----------------------------------------------------------------------
00499001   1/1  ----------------------------------------------------------------------
00499051   1/1  ----------------------------------------------------------------------
00525881   1/1  ----------------------------------------------------------------------
00367951   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LAGDGDTTSPKSGSGAQFSSPEGVASGQSEQLPYFRDYYSQDDIHPNDKVAVLWAYQPRAADEFELERGD
00498671   1/1  -------------llgnldgllglvpasyvsllpppppppppsppplllvrAlydyeaqnddeLsfkkGd
00413741   1/1  -------------------------------------------applpppplpalglelvvalydYtaqd
00388381   1/1  --------------------------splpllaslslpllllaslplelvvAlydYtaqdedeLslkkGd
00505831   1/1  ------------------------------lllslsslspllsllplllavAlydYeaqesnledaedeL
00449151   1/1  --------------------deilevnglglrglfpaeyvpvl....vyvrAlydYdaqeddeiPckeaa
00499261   1/1  -------------------------------------plpllsllvlllvvAlydyeaqdddeLsfkkgd
00427051   1/1  -------------------------------------------llslllvvalydyeaqdddeLsfkkgd
00423231   1/1  --------------------------------------------sglllvvAlydyeaqeedeLslkkGd
00477241   1/1  -----------------------------llllslllllsllsllvlllvrAlydyeaqeddeLslkkGd
00469571   1/1  --------------------------------------ppllslpvlllvvalydyeaqnddeLsfkkGd
00498711   1/1  ----------------------------------------llspsvlllvvalydyeaqdddeLslkkGd
00459201   1/1  -----------------------------------llpplslslpplllvvAlydytaqdddeLslkkGd
00420391   1/1  --------------------------------------lsllsllvlllvvalydyeaqdddeLslkkgd
00470081   1/1  ---------------------------------------------llllvvalydyeaqdddeLslkkgd
00505081   1/1  ----------------------------------------gsssssgelyvalydYeaqnedeLslkkGd
00376671   1/1  ---------------------------------------------llllvvalydyeaqnddeLsfkkgd
00478191   1/1  ----------------------------------------------llyvrAlydyeaqedddlpvqeLs
00469061   1/1  --------------------------lgllsllppppvppllsllvlllvvAlydyeaqeddeLsfkkGd
00458131   1/1  --------------------------------------------lllllvvalydyeaqnddeLslkkgd
00476421   1/1  -----------------------------------------------llvvalydyeaqdddeLslkkgd
00493761   1/1  ---------------------------------------------llllvvalydytaqdddeLslkkgd
00491751   1/1  ---------------------------ekaekelrkkfllpgeilvltlavalydfvteaqgedeLsvkk
00470431   1/1  ---------------------------------------------llllvvalydytaqdddeLsfkkgd
00458351   1/1  ---------------------------------------lllllpvlllvvalydyeaqdddeLslkkgd
00438541   1/1  -------------------dellellgleveslspspllpllsppvleyvrAlydYeaqeddeiPlkeag
00360291   1/1  ----------------------------------------------lllvvalydytaqdddeLslkkgd
00458341   1/1  ---------------------------lllpspsppppllllsllllllvvAlydyeaqdddelsfkkgd
00500001   1/1  ----------------------------------------------lllvvalydyeaqnddeLslkkgd
00476631   1/1  ---------------------------------llllssllllllllllvrAlydyeaqnddleLsfkkg
00498821   1/1  ------------------------------------------gspplelvvAlydyeaqnddeLsfkkGd
00472331   1/1  -----------------------------------------llllvlllvvalydyeaqdddeLsfkkgd
00477481   1/1  ------------------------------------------lllllllvvalydyeaqdddeLslkkgd
00485501   1/1  ------------------------------------------lllllllvvalydyeaqdddeLslkkgd
00477651   1/1  -----------------------------------------llllvlllvvalydyeaqeddeLsfkkGd
00450821   1/1  -------------------------------------------llvlllvvalydyeaqdddeLslkkgd
00384781   1/1  -------------------------------------------------lllvvalydytaqnddeLslk
00413381   1/1  ----------------------------------------------lvlvvalydytaqdddeLsfkkgd
00436131   1/1  ----------------------------------------------lllvvalydyeaqnddeLslkkgd
00494391   1/1  ----------------------------------------llsllslllvvalydyealqdddeLsfkkG
00367941   1/1  --------------------------------------------lglllvvalydyeaqdddeLslkkgd
00499001   1/1  -------------------------------------llllslllllllvvalydyeaqnddeLsfkkgd
00499051   1/1  ---------------------------------------lllsllvlllvvalydyeaqdddeLsfkkgd
00525881   1/1  --------------------------------------------lglllvvalydyeaqnddeLslkkgd
00367951   1/1  ------------------------------------------------galelllvvalydyeaqnddeL


                         -         -         +         -         -         -         -:490
query           MLKVVGIWDDGWATGIRLNETVEDYDGKHKAQRDSGVSNGTDRRGSSPAPTGEIKAFPLVCVCLPEHWRK
00498671   1/1  iitvlekvddgWwlgrl-----------------------------------------------------
00413741   1/1  edeLsfkkGdvievlekvddgW------------------------------------------------
00388381   1/1  iievleklagdddgwweGellgdskgdl------------------------------------------
00505831   1/1  sfkkGdiitvlekvdddgWweg------------------------------------------------
00449151   1/1  LsFkkGDilevleksddgWwlgrlvkengkeGlfPsnyveelrellaelslsrssspsssslirase---
00499261   1/1  iitvlekvddgwwlg-------------------------------------------------------
00427051   1/1  illvlekvddgwwlgrllngke------------------------------------------------
00423231   1/1  iitvlekdllllllll------------------------------------------------------
00477241   1/1  iitvlekvaddgWwegr-----------------------------------------------------
00469571   1/1  iltvlekdvddgwwlgr-----------------------------------------------------
00498711   1/1  iitvlekvddgWwlgrllddsgngkvG-------------------------------------------
00459201   1/1  iitvlekvlkeedddgWwlgellseledls----------------------------------------
00420391   1/1  vilvlekvddgwwlgrl-----------------------------------------------------
00470081   1/1  illvleksddgWwlgrnlngkv------------------------------------------------
00505081   1/1  vvevleksddgwwlvrlla---------------------------------------------------
00376671   1/1  iilvleklddgwwlgrllsngkvGl---------------------------------------------
00478191   1/1  fkkGdilevleksddgWwlg--------------------------------------------------
00469061   1/1  iitvlekvddgWwlg-------------------------------------------------------
00458131   1/1  iilvleklddgwwlgrllsn--------------------------------------------------
00476421   1/1  illvleklddgWwlgrllsngkvGl---------------------------------------------
00493761   1/1  illvleklddgwwlgrl-----------------------------------------------------
00491751   1/1  Geilevleksddgwwlarn---------------------------------------------------
00470431   1/1  illvleklddgwwlgrl-----------------------------------------------------
00458351   1/1  illvlekvddgWwlgrllngkv------------------------------------------------
00438541   1/1  LsfkkGdvlevleksddgWwl-------------------------------------------------
00360291   1/1  illvleklddgwwlgrllggkv------------------------------------------------
00458341   1/1  iltvleksddgWwlgrnlngke------------------------------------------------
00500001   1/1  illvleklddgwwlgrl-----------------------------------------------------
00476631   1/1  diltvleksdllgnddgWwlgr------------------------------------------------
00498821   1/1  iitvlekvdgddgWw-------------------------------------------------------
00472331   1/1  iitvlekvddgWwlgel-----------------------------------------------------
00477481   1/1  iilvleklddgwwlgrl-----------------------------------------------------
00485501   1/1  illvleklddgwwlgrl-----------------------------------------------------
00477651   1/1  iltvlekvdddgWwlgrllngk------------------------------------------------
00450821   1/1  illvleklddlddgwwl-----------------------------------------------------
00384781   1/1  kgdillvlekvddgw-------------------------------------------------------
00413381   1/1  illvleklddgwwlgrl-----------------------------------------------------
00436131   1/1  illvleklddgwwlgrllsngrvGl---------------------------------------------
00494391   1/1  diitvleekvddgWwlg-----------------------------------------------------
00367941   1/1  illvleklddgwwlgrl-----------------------------------------------------
00499001   1/1  iitvleekvddgWwl-------------------------------------------------------
00499051   1/1  iltvlek.ddgWwlgrl-----------------------------------------------------
00525881   1/1  illvleklddgwwlgrl-----------------------------------------------------
00367951   1/1  sfkkgdillvleksd-------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           TIEGDPQTRSSMDSQ-------------------------------------------------------
00498671   1/1  ----------------------------------------------------------------------
00413741   1/1  ----------------------------------------------------------------------
00388381   1/1  ----------------------------------------------------------------------
00505831   1/1  ----------------------------------------------------------------------
00449151   1/1  ----------------------------------------------------------------------
00499261   1/1  ----------------------------------------------------------------------
00427051   1/1  ----------------------------------------------------------------------
00423231   1/1  ----------------------------------------------------------------------
00477241   1/1  ----------------------------------------------------------------------
00469571   1/1  ----------------------------------------------------------------------
00498711   1/1  ----------------------------------------------------------------------
00459201   1/1  ----------------------------------------------------------------------
00420391   1/1  ----------------------------------------------------------------------
00470081   1/1  ----------------------------------------------------------------------
00505081   1/1  ----------------------------------------------------------------------
00376671   1/1  ----------------------------------------------------------------------
00478191   1/1  ----------------------------------------------------------------------
00469061   1/1  ----------------------------------------------------------------------
00458131   1/1  ----------------------------------------------------------------------
00476421   1/1  ----------------------------------------------------------------------
00493761   1/1  ----------------------------------------------------------------------
00491751   1/1  ----------------------------------------------------------------------
00470431   1/1  ----------------------------------------------------------------------
00458351   1/1  ----------------------------------------------------------------------
00438541   1/1  ----------------------------------------------------------------------
00360291   1/1  ----------------------------------------------------------------------
00458341   1/1  ----------------------------------------------------------------------
00500001   1/1  ----------------------------------------------------------------------
00476631   1/1  ----------------------------------------------------------------------
00498821   1/1  ----------------------------------------------------------------------
00472331   1/1  ----------------------------------------------------------------------
00477481   1/1  ----------------------------------------------------------------------
00485501   1/1  ----------------------------------------------------------------------
00477651   1/1  ----------------------------------------------------------------------
00450821   1/1  ----------------------------------------------------------------------
00384781   1/1  ----------------------------------------------------------------------
00413381   1/1  ----------------------------------------------------------------------
00436131   1/1  ----------------------------------------------------------------------
00494391   1/1  ----------------------------------------------------------------------
00367941   1/1  ----------------------------------------------------------------------
00499001   1/1  ----------------------------------------------------------------------
00499051   1/1  ----------------------------------------------------------------------
00525881   1/1  ----------------------------------------------------------------------
00367951   1/1  ----------------------------------------------------------------------