[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_00742


[Show Plain Result]

## Summary of Sequence Search
   1::241
   2::241  2.6e-39 46.3% 0046143 00461431 1/1   inding split barrel                     
  70::241  2.9e-36 48.0% 0051690 00516901 1/1   inding split barrel                     
   2::241  4.5e-35 40.7% 0048424 00484241 1/1   inding split barrel                     
   2::241  3.8e-33 44.0% 0046934 00469341 1/1   inding split barrel                     
   2::241  1.6e-31 42.7% 0049738 00497381 1/1   inding split barrel                     
   2::241  1.3e-30 43.3% 0049578 00495781 1/1   inding split barrel                     
  70::214  2.2e-17 40.5% 0053062 00530621 1/1   inding split barrel                     
  70::214  3.8e-16 45.6% 0053033 00530331 1/1   inding split barrel                     
  70::218  9.9e-14 35.8% 0049155 00491551 1/1   inding split barrel                     
  70::211    8e-12 39.0% 0052694 00526941 1/1   inding split barrel                     
  70::205    3e-10 33.8% 0051821 00518211 1/1   inding split barrel                     
  70::206  0.00016 24.1% 0050409 00504091 1/1   inding split barrel                     
   1::241


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPSGRVSARIVYLKELDERGWVVYSNWGSRAGKGGQVFGTETGIDVNGREEEEEVGEEGSVIPDDGQGKL
00461431   1/1  -adGrPrvrtvlfrgvdddgllfytdlarsr..KvrnL................................
00516901   1/1  ---------------------------------------------------------------------l
00484241   1/1  -adGrPrvrpvlfrvlddgtlvfatnarsr..kvrnlaan..............................
00469341   1/1  -adGrPrvrpvlfrgldddglvfatnlrsr..kvrnl.................................
00497381   1/1  -adGrPrvrpvlfrvlddgtlvfatnarsr..kvrnla................................
00495781   1/1  -adGrPrvrpvlfrglddgtlvfatnarsr..kvrnla................................
00530621   1/1  ---------------------------------------------------------------------l
00530331   1/1  ---------------------------------------------------------------------L
00491551   1/1  ---------------------------------------------------------------------l
00526941   1/1  ---------------------------------------------------------------------l
00518211   1/1  ---------------------------------------------------------------------l
00504091   1/1  ---------------------------------------------------------------------l


                         -         -         *         -         -         -         -:140
query           EGNRWAALTFNWPSVERQVRVEGLIEMLSREESETYWRVRERGSQIGAWASQQSKVLWSTEPRDMEGVDA
00461431   1/1  .aanprvsllfydpelgrqvrieGtaevvsdeeldaywasrprgsrlgawaspqstpl............
00516901   1/1  aanprvsllfydpelgrqvrirGtaevvsdeeaeeyfasrpkasqigawaspqstpi.............
00484241   1/1  ...prVsllfydpglgrqvrieGtaevvddeelealwasrprlsrigawasppgqpl.............
00469341   1/1  aanprvsllfydpelgrqvrvrGtaevvdddeldeyfasrprlsrlgawasppgtpl.............
00497381   1/1  .anprvsllfydpglgrqvrvrGtaevvdddeldeyfasrprksrigalasppgtpl.............
00495781   1/1  .rnprvsllfydpglgrqvrveGtaevvddeeldayfasrprlsrlgawasppgtpl.............
00530621   1/1  ranprvsllfldpdggrsvrveGtaevveddeelaallsrlleaylga......................
00530331   1/1  aanprvallfldpdlgrqvrveGraeivedpelkdalasrllksylg.......................
00491551   1/1  rrnprVsllvvdpelglpyrgvrveGtaeivedpeeleellsrllkkylgagadeqsppi..........
00526941   1/1  ranprvsllfvdp..grsvrleGtaevvtdre......................................
00518211   1/1  aanprVsllvddpeggdplnyrrvrleGtaelvedeelealldrllarypdaael...............
00504091   1/1  rrdprvsllvddpdggrsvtveGraeiveddellaeaaralllayygalagell................


                         +         -         -         -         -         *         -:210
query           VPGAASRLKDINSQSGEEDDGRSVLENRVKEMEKRFADTEEIPLPPFWGGVRLVPESVEFWQGRKSRLHD
00461431   1/1  ....................dsrdalllkvleleakfadgedvprPenfgglrlvpeeveflqlredrlh
00516901   1/1  ...................dsravlldlvaellakfaglgdvprPenfgglrlvpleveflqlredrlhd
00484241   1/1  ...................ddpevlllkvaeleaeyld.gdvprPenfgglrlvpeeveflqlredrlhd
00469341   1/1  ...................ddrdvlllkvaeleakfldge.vprPenfgglrlvpeeveflqlredrlhd
00497381   1/1  ...................dsravlldvvaelaelf...ddvprPenfgglrlvperveflqlredrlhd
00495781   1/1  ...................dsravllavlaelaalf...ddvprPenfgglrlvpeeveflqlredrlhd
00530621   1/1  .........................................gpdppdfvvlriepeeiefwdgggnrlhd
00530331   1/1  ........................................egpdppdfvvlrvepeeiefwdgrggrlhd
00491551   1/1  ............................................lprdpdfvvlritpervefwdgggga
00526941   1/1  .......................eleelweallekyfp..egpddpdlvllrvtpeeiefwdgggsrlhd
00518211   1/1  ..............................................pdlpdfvl.irlepeeief-----
00504091   1/1  ..................................dldearllpdlpdfvlvriepervlgvdgfgk----


                         -         -         -         +         -         -         -:280
query           RFRYVRVHGENEHLGEGDEKTFRWRIQRLSP---------------------------------------
00461431   1/1  dRllytrvlddg...........gWeierla---------------------------------------
00516901   1/1  Rlly.................ggweierlaP---------------------------------------
00484241   1/1  RllytrdddgdekeleelllleeedWvierl---------------------------------------
00469341   1/1  Rllytrdddg.............weierlaP---------------------------------------
00497381   1/1  Rllytr.........dddg....weierlaP---------------------------------------
00495781   1/1  Rllytrddgg.............weierlaP---------------------------------------
00530621   1/1  rlly------------------------------------------------------------------
00530331   1/1  rley------------------------------------------------------------------
00491551   1/1  lhdrllyr--------------------------------------------------------------
00526941   1/1  r---------------------------------------------------------------------
00518211   1/1  ----------------------------------------------------------------------
00504091   1/1  ----------------------------------------------------------------------