[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_00779


[Show Plain Result]

## Summary of Sequence Search
   1::1773
 664::1341 5.5e-21 18.6% 0045874 00458741 1/1   epeat                                   
 362::1517 2.2e-17 18.5% 0049802 00498021 1/1   epeat                                   
 843::1519 2.4e-17 18.3% 0047075 00470751 1/1   epeat                                   
 846::1398 6.4e-17 21.0% 0038302 00383021 1/1   epeat                                   
 290::1306 7.9e-16 21.0% 0050417 00504171 1/1   epeat                                   
 499::1306 1.5e-14 19.8% 0048921 00489211 1/1   epeat                                   
 501::1398 7.5e-10 20.2% 0052026 00520261 1/1   epeat                                   
 864::1350 1.9e-09 19.8% 0046912 00469121 1/1   epeat                                   
 867::1342 1.5e-08 16.7% 0047335 00473351 1/1   epeat                                   
 868::1453 2.1e-08 20.3% 0050416 00504161 1/1   epeat                                   
 866::1010 2.7e-08 19.4% 0048666 00486661 1/1   epeat                                   
 875::1009 5.9e-07 20.7% 0043958 00439581 1/1   epeat                                   
 865::1009   1e-06 22.2% 0051023 00510231 1/1   epeat                                   
 502::1310 2.3e-06 20.3% 0042771 00427711 1/1   epeat                                   
 867::1010 0.00081 18.8% 0051071 00510711 1/1   epeat                                   
   1::1773


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQQQRQPGLAVVIQGNGTSSRASQRLPRPLSVDEALQYSPMTSAPVFGLDSIMRPDVGQPSLSGWPRPYD
00458741   1/1  ----------------------------------------------------------------------
00498021   1/1  ----------------------------------------------------------------------
00470751   1/1  ----------------------------------------------------------------------
00383021   1/1  ----------------------------------------------------------------------
00504171   1/1  ----------------------------------------------------------------------
00489211   1/1  ----------------------------------------------------------------------
00520261   1/1  ----------------------------------------------------------------------
00469121   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ----------------------------------------------------------------------
00510711   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SQVAGRITDSLDNETQASSGLGESTRLETAREYLQQLLRQDNLTDFNFKVPPSLRSDSSPQKNGESLSRS
00458741   1/1  ----------------------------------------------------------------------
00498021   1/1  ----------------------------------------------------------------------
00470751   1/1  ----------------------------------------------------------------------
00383021   1/1  ----------------------------------------------------------------------
00504171   1/1  ----------------------------------------------------------------------
00489211   1/1  ----------------------------------------------------------------------
00520261   1/1  ----------------------------------------------------------------------
00469121   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ----------------------------------------------------------------------
00510711   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           QLGPFAKLILDSTDATFHYSTPTTTNSEKHHQSSNTLPTPLSSSKPPYSANKEDQMRQQLEKLMKPMVII
00458741   1/1  ----------------------------------------------------------------------
00498021   1/1  ----------------------------------------------------------------------
00470751   1/1  ----------------------------------------------------------------------
00383021   1/1  ----------------------------------------------------------------------
00504171   1/1  ----------------------------------------------------------------------
00489211   1/1  ----------------------------------------------------------------------
00520261   1/1  ----------------------------------------------------------------------
00469121   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ----------------------------------------------------------------------
00510711   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PGLAPSSNIEDFKYVSGEGSAKRRKLDSNNEEKQDPLPLRDQKELSDTALVKLQSLLHEIFEAEEQLLPD
00458741   1/1  ----------------------------------------------------------------------
00498021   1/1  ----------------------------------------------------------------------
00470751   1/1  ----------------------------------------------------------------------
00383021   1/1  ----------------------------------------------------------------------
00504171   1/1  ----------------------------------------------------------------------
00489211   1/1  ----------------------------------------------------------------------
00520261   1/1  ----------------------------------------------------------------------
00469121   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ----------------------------------------------------------------------
00510711   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           APLDAQAGGKFFKFPNTIGDLGPIMSSETHEVLSKALQKVSDYRRLGDIPTEYIKHIQRLCEAPIMAVQS
00458741   1/1  ----------------------------------------------------------------------
00498021   1/1  ----------------------------------------------------------------------
00470751   1/1  ----------------------------------------------------------------------
00383021   1/1  ----------------------------------------------------------------------
00504171   1/1  ---------MddleqllqllyaspdpevrkqAeeqLeqlqkspefllllleilssssldpevrffAailL
00489211   1/1  ----------------------------------------------------------------------
00520261   1/1  ----------------------------------------------------------------------
00469121   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ----------------------------------------------------------------------
00510711   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ADFKLESPPSDTDIERWITQLEDVQNALLAIITLLQTMPGNQSTKDLCPEDLIHAIPTALGQVFDHCIIP
00458741   1/1  ----------------------------------------------------------------------
00498021   1/1  -----------asellaellealkskdpdvRlealqeLkkllkkgweelpeedlsellplllkllsspdp
00470751   1/1  ----------------------------------------------------------------------
00383021   1/1  ----------------------------------------------------------------------
00504171   1/1  knlikknwsslednnalpeeekeeiknsllqllidspplvrnklaqalaeiakrdfpeewpellpdllql
00489211   1/1  ----------------------------------------------------------------------
00520261   1/1  ----------------------------------------------------------------------
00469121   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ----------------------------------------------------------------------
00510711   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VVECRSSGKDSTHFHVFSAQKQVISNVIHQTKRVLSRLAVFLSNVDLAEGPITAIEFLAARLIFVENAPN
00458741   1/1  ----------------------------------------------------------------------
00498021   1/1  evrkaaalaLanlakkldeellelllplLlkllsspdpevrelalraLasiakrlgpgaaspelveelld
00470751   1/1  ----------------------------------------------------------------------
00383021   1/1  ----------------------------------------------------------------------
00504171   1/1  lqspnpelregalliLkelveelrdlllsdelqkrrklllelleedlpeilplllqlledssddvrllal
00489211   1/1  ----------------------------------------------------------------------
00520261   1/1  ----------------------------------------------------------------------
00469121   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ----------------------------------------------------------------------
00510711   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           DKESAIGVQKYEASRRAAMDVLAKIFAKYPEQRPFILDEILVSLEKLPSNRQSARQFKLIDGKSIQLLSA
00458741   1/1  ----------------------------------------------------------------------
00498021   1/1  ellplll...............................................................
00470751   1/1  ----------------------------------------------------------------------
00383021   1/1  ----------------------------------------------------------------------
00504171   1/1  slevrklalkalgsll.widlpeifedlleellelllkllesldplleavdddeele.............
00489211   1/1  --------spdpkvrkaalealgelaerypdflkpylpdllplllklledkdpevrlaaleflstlakqk
00520261   1/1  ----------PmdleqllqlLqallspdnevrkqAeeqLkeleknnppefllllleilldsssdpeiRql
00469121   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  -----------pevrlaalkalaslleslpsn..eeledllds...........................
00510711   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           LVIQLVQTTALRQTSSRLTVAKGSLQKATNSLDESDEEDEEDSNNGSERKTSPIKQLSKQVELLYDNAIH
00458741   1/1  ----------------------------------------------------------------------
00498021   1/1  ...................................................sllksdkdpevreaallal
00470751   1/1  ----------------------------------------------------------------------
00383021   1/1  ----------------------------------------------------------------------
00504171   1/1  ......................................................................
00489211   1/1  llpkllepyleellplllkllsldpedlelweddpeeyvrdededsderplsgkareavsdvleklleee
00520261   1/1  AailLknllkknwrptddefaerlwpaldeeekeqiknlllqlllepdplvrsaaaealaaiaridlpeg
00469121   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ......................................................................
00510711   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           SAQYVTKFIVQRAMTSTKSGDQPYRNLLDIFTEDLISVLGSTDWPGAELILRVLASQMITIADHDKSSAN
00458741   1/1  ---------------------------------laledeellelleellellkskdeevrlsalkaLael
00498021   1/1  akllknlpelleplledllplllkllsdpdpe.....vRkaAaealgallkklpd...............
00470751   1/1  ----------------------------------------------------------------------
00383021   1/1  ----------------------------------------------------------------------
00504171   1/1  ...................................................plekvrkaaleclgelasl
00489211   1/1  dedeededdd............................................................
00520261   1/1  lwpellplllellkspsdpelreaallalselleelrellqeileellplllkllevllssdpspevrla
00469121   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ......................................................................
00510711   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           AKNMSLELLGWMGSAISDLTSTAQHLSNTLEDGHTDLTDHLRNLFHDYSNRALHIQDIVSLDGPYRMTLE
00458741   1/1  iralgpeedlsellplllkllespd..evrklallaLgellkllpel.ellelllplllkll........
00498021   1/1  ......................................................................
00470751   1/1  ----------------------------------------------------------------------
00383021   1/1  ----------------------------------------------------------------------
00504171   1/1  ypsl..................................................................
00489211   1/1  ..............................ddd.edwsvrraaaellgalasllgpevlpl.........
00520261   1/1  alkalgsllrsld.........................................................
00469121   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ......................................................................
00510711   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           YLEEGDLGSWQLSSARGYLIAQWAKLVCSGYEDSAQGGSTKNPQGAGKLAKALSHILSNPKWLESNSAFD
00458741   1/1  ..................................................................kspd
00498021   1/1  ......................................................................
00470751   1/1  ----------------------------------------------------------------------
00383021   1/1  ----------------------------------------------------------------------
00504171   1/1  .................................................................lgpyl
00489211   1/1  ......................................................................
00520261   1/1  ..........................sslefeelldqilelllellsdedeevrkaalkcLgrllelype
00469121   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ......................................................................
00510711   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           RISTQQARFAYLIIVLSSGFCKGFDTIVKVLLNSITSDQAKVRSRSLKSVIHMLERDPSLLDRDGSVISL
00458741   1/1  plvreaalralgsllellpp............................pelledllplllkllkdkdpkv
00498021   1/1  ......................................................................
00470751   1/1  --gmrgladlikslrelksleeerkriskelaelrkllksdtpldpskrlealkkllyllllgedvsell
00383021   1/1  -----reaalealgklarsdpeelekllplllkllsdpnpavrlealkalgnllenpkaleelidellel
00504171   1/1  eqilplllkllqspdldplseevrlaaleflsslleseplkkllltkpilpellellikpllk.......
00489211   1/1  ................................................................llpill
00520261   1/1  lllpylekllelllkllskde.dpevrlaaleflsslaksegkillkaledkkeerrspellkpyleelv
00469121   1/1  -----------------------ealgslinklgdpellpellplllellkskdeevrkkalealgelak
00473351   1/1  --------------------------eelllkrrnvllqlsdllseleslldllesleelleellrllqs
00504161   1/1  ---------------------------mednarlknfknkekldleelrrkreefrveiRkkkreellkk
00486661   1/1  -------------------------lkllrleaayalgeigdpgavplLlellkdedpevrlaaakaLge
00439581   1/1  ----------------------------------Lkdpdpevrlaaalalgnl.........gde.avpl
00510231   1/1  ------------------------egllpalllellkdsdpevreaalralgnlasgspelaeellelgv
00427711   1/1  ..........................llplllkllkdpdpevreaalealgellellpdllrpyledgll
00510711   1/1  --------------------------pellkellkslevdaellelllellqsdedeevrlaalraLrnl


                         -         -         -         +         -         -         -:980
query           ILRCATDSSPMVRDSALSLIAKCMFLKPGLEENCCRAILACSSDPTVGVRKRAIGLMKDVYIQTSNQELK
00458741   1/1  rkaalealgkllellpelll..pellplllkllsdpdpevrkaaleaLgellknlpeeelleellpllle
00498021   1/1  .....................................................................e
00470751   1/1  pellkllsspdpevrrlaylalselaeedpdllll...linlllkllkdpdpevreaAlraLgkla..dk
00383021   1/1  LlkilellsdsdpevryaalraLgklakslpelvlpylp.llellkdddlsvrlealellsklv....ne
00504171   1/1  ......................................................................
00489211   1/1  qllsssdwrvreaallalgslaeglpdqlkpflp.qilpallpllsdpsplvraaalealgklaevlpne
00520261   1/1  pvllkllsdddededddewsvrraaadal.........................................
00469121   1/1  klpdelllalleellpaLlkllsspdpeevreaalralaklledlpprlalilegilplllkllkdpdpe
00473351   1/1  pdpevrlsalkalgellslnndelaeliiesgllpallellsndpdpevrlaallaLgnlasgnpenlep
00504161   1/1  kRnislndeeselledlldlleeleddleelleelpellellnsedpevrlqalkaLgkllssekeelle
00486661   1/1  i.........gdpealplliellkdedeevreaaaealgriakdlglfddallpllilllsdedpsvrra
00439581   1/1  LlellsdedplvrraaaraLgnl......gdeealplllellededplvrraAaeaLgnlgd........
00510231   1/1  lplllellessedpevreaalgaLgnlarsepnrlkllealilkeegilplLlellssedpevreaaaga
00427711   1/1  plllkllkdpdpevrlaaleflstlakalpkllkeeedpelldlieeilppllaegllellvplldeele
00510711   1/1  aedpdnaealielgglplLleklLkspdpevreaAaraLgnlasgnpenrealveagalplLlqlLsssp


                         -         *         -         -         -         -         +:1050
query           LTIIEQLLLRVTDYESSVAVQASQALEEIWFSPLHSSFTESTQGTPQSKVSLKNLMNLIVGSVRRNEGVI
00458741   1/1  llkdpdpevrlaalkaLgalleglpeepllpkllplllellsdpspevraaalkalgkllsnlppeille
00498021   1/1  lleellpallellkedpdpevrkaalelLgellesnpellksllp.ellplllkllsdpdpevrlaalel
00470751   1/1  elleellpillellssldpdpsvRkaAalaLgnlaeglpdllklvgllplllklLndpdpeVreaaleaL
00383021   1/1  enleeilkeLlellsdpdpevreealralgel......................................
00504171   1/1  ............................................................lseedleewe
00489211   1/1  lqpefleqllplllelLqdpspsvreaalkaLsnllellp.evlspylpellpallkllkdpdeevreaa
00520261   1/1  ......................................................................
00469121   1/1  vrraaaraLgnlasgdpellealveagllplLlklLsdpdpevreaaaeaLgnlaeds............
00473351   1/1  lleagalpaLlelLsdpdpevreaalraLgnlakdspelrdalleagilppLlellknlllsdpdpevre
00504161   1/1  eliesgllpllvkllkspdpeevrlaalkaLgnlasgspellealleqgilplLlklLsdpdpevreaal
00486661   1/1  aaealgnlgdnfp..elveealplllkllk----------------------------------------
00439581   1/1  pealplLlellkdededvrlaaalaLgnl-----------------------------------------
00510231   1/1  Lgnlasdpenleelle.gllplLlklled-----------------------------------------
00427711   1/1  eddddeddddeslrkaaaealgrlakllgeevlelllplllkllsspdwrvReaallalgsiaeglpedl
00510711   1/1  dpevreaalwaLgnlardspearealleag----------------------------------------


                         -         -         -         -         *         -         -:1120
query           ATFEAFVKDELSAEAKSASLNFNVCKAVVAAMFDRIIHDSDKTDKRTLQSLLQSITVFARANAKLFTPDQ
00458741   1/1  kll...................................................................
00498021   1/1  lsalaellpellkpllekllpallkllssdpdpevrkealdaleelledlpddlelliklledlddddpn
00470751   1/1  gnlakdsp..........................................................ellk
00383021   1/1  .................................................................asklp
00504171   1/1  ddpeefirddldddddesvRraaaelLgrlakllpe..evlplllplliqllssllngpsedwrvreaal
00489211   1/1  lealgslasvlgedllq.....eelldkllplllellkdlesdpelreaalealgsll..........ka
00520261   1/1  ............dalasvlgd...eilplllpfllellsssnwrvreaallalgslaegtpeeklkpllp
00469121   1/1  .....................................pelrdplleegllpaLlkll.......kdpddp
00473351   1/1  aaasalanlardaeprkdapylegllpiLlellkdpdpevreaaleaLgnlaeg................
00504161   1/1  raLgnlasdspelrdplleegllpallkllkdedpevrrnaleaLgnlcrgleplddleyv.........
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  lspllpellpallqllndpnprvraaalwalgrlasklspeglppeflkqllplLlellkd.sprvrsaa
00510711   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           LETLHPYIGHLSNADDLMLFRSVVVIYRCVLPYLSTSHNTLLKDIQNDLFKSVSKLARTELNEVMACLWT
00458741   1/1  .plllellkdpdpevreaaleaLgslleslpellspelyleellplllellsdpdpevreaalealgkla
00498021   1/1  vrraalealgklakllpelllpfleellpallellsdpdpevreaalealgslaellgpdlledllpell
00470751   1/1  pllegllplLlkllsdpdpeesdydysgvpspwvreaaleaLgnlaegidpelleplleellplLlklls
00383021   1/1  pdfeqllplllkllsdedpevrlaalealgnlle....................................
00504171   1/1  lalgslaqkeglpeegsteksdlvpllpqllplllellkdgnvpnplvraaalealgrlaevlgpeflee
00489211   1/1  lgee.flpllekliplllellsslldedededeeddeeddddselregallllstllkalgeeflp.ylp
00520261   1/1  ellplllsllkdpnpevreaalwaLgrlaedlpevldnlelleqllpallkllkd.npevrraaasaLgn
00469121   1/1  evrraaleaLgnla.snpelreelvlpgllpvLlkllkdpdpevreaalkaLgnllsvlpe..qplieel
00473351   1/1  ..........................................dpeniellveagllpllvellsdsdpev
00504161   1/1  ......................................................................
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  asaLgnllellgeek............................................savieagelpt
00510711   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:1260
query           INGVLQNTERLVKLTISVLKGINQAVSAKVDPSTSADVLGRVRSYIRIAGCVGKHCDLESFLAFFSQSFP
00458741   1/1  kllgneelaeellplLlkllkde.dpevreaalealgdllkklg....lpplleellplllelledpdpe
00498021   1/1  sl...........................................leslselleelleellplLlellnd
00470751   1/1  stddskvlanssdpevrlealkalgnl.....eafpellegllplLlells...dedpevreaalealgn
00383021   1/1  ......................................................................
00504171   1/1  llplllklLsdsdpevreaAaraLgsllesleeafvtlqvlfpeelepylpellpallkllsdpseevre
00489211   1/1  qsellplllellkdespevreaalkllgdllealpee....lspyleellplllellndpdpev......
00520261   1/1  llelldplseedlepyleellpiLlkllkkqdpdpevreaalealsslikalgeeiepyleellplllel
00469121   1/1  lplLlkllsd...pdpevreaalraLgnlakgdpegleplleagllplLlelLknsdpd...........
00473351   1/1  reaalraLgnlasgspelleplldlgllplllkllsdpdpevreaalkaLgnlaa...............
00504161   1/1  .....................egllplLlellkdpd....pevreaaleaLgnlaesnpeliealiesgi
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  svlspylpellpaLlellsrysdenpevreaalealgelvsvsgedllpyidellplllellsd......
00510711   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:1330
query           HMKATSVSGLMVDFISPFASSKYPHELRVMALESLGAICETWPAQYSREPAKIAFTSVFEEDSPDLQNIV
00458741   1/1  v...............reaalellgelasllg...lkpflpellplllkllsdpspevreaalealgkll
00498021   1/1  espevreaalkalgrlaeklpelle.eylekllplllellsdedpse.......................
00470751   1/1  lasalgqpellepylpvllelLkn..............................................
00383021   1/1  .....kvpellepvlpallelledsespevrraaawalgelaellp.e..ledilplLlellkdedpevr
00504171   1/1  aaelenalealgtlvkalpdeltpyleellplllqllkells....------------------------
00489211   1/1  .........................................rqaal------------------------
00520261   1/1  lsklls.....................ellnyvseldsdedpelraaalrllgnllsklgeqfqplledl
00469121   1/1  ............................................................pevrkealwa
00473351   1/1  ......................................................................
00504161   1/1  lplllellksedeevreaalraLgnlasgnpelleelleagilpallkllk...................
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ..................llqkskallelalkdedpelrkaalealglla--------------------
00510711   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:1400
query           LKGFLAFFSIHEGKSEKLIQTKDTNGKSEGSTRLGGSLKASENDGAAALIAQHFLQQMLHAALSKEDSHA
00458741   1/1  rklpeepylee-----------------------------------------------------------
00498021   1/1  ...................................................................evr
00470751   1/1  ........................dpdpsvrkaalealsnlan...................eenleell
00383021   1/1  eaalsalaklllklpeelkp....................................lllqllelllnd--
00504171   1/1  ----------------------------------------------------------------------
00489211   1/1  ----------------------------------------------------------------------
00520261   1/1  lplllellsssdddsvreealealsnlakalgelfsp.yleqllplllellsdddeevreaalellgn--
00469121   1/1  Lgnlaaglppseelrlalll--------------------------------------------------
00473351   1/1  ............----------------------------------------------------------
00504161   1/1  ............................................dp.dpevrkaaawaLgnlaagnpeli
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ----------------------------------------------------------------------
00510711   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:1470
query           LTGIELIASINRQGLIHPKECAGVLVALETSTNASIANVAFETHKMLHQQHESMFDREYMRAVQDAFYYQ
00458741   1/1  ----------------------------------------------------------------------
00498021   1/1  eaalsalgellenlspellvpyledlleallkllsdeneevrlaalkalgkllkvlgeslpeseelfkpl
00470751   1/1  pellell..........................................................kdpdp
00383021   1/1  ----------------------------------------------------------------------
00504171   1/1  ----------------------------------------------------------------------
00489211   1/1  ----------------------------------------------------------------------
00520261   1/1  ----------------------------------------------------------------------
00469121   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00504161   1/1  qelleegllplLikllsdpnpevrkaalkalgnllekape.seellelllelg-----------------
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ----------------------------------------------------------------------
00510711   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:1540
query           RDVVGDPTGASTRPFTAKLAALFEIIKISNSKYQKKFLTNLCSKVDFQPRALDVAGSPPEHMLLARFVCQ
00458741   1/1  ----------------------------------------------------------------------
00498021   1/1  ldellplllelledksddpevreaaleaLgllakalgelfspyleel-----------------------
00470751   1/1  evreaalealgnlaeklppdlekilpallkllsdpdeevreealealan---------------------
00383021   1/1  ----------------------------------------------------------------------
00504171   1/1  ----------------------------------------------------------------------
00489211   1/1  ----------------------------------------------------------------------
00520261   1/1  ----------------------------------------------------------------------
00469121   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ----------------------------------------------------------------------
00510711   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:1610
query           NLAYFEYAQIGELLATVACMERIVASTGTTVAHAIETDIFPVKIDCPNEQMQVDGAAADQAPHSVDPNSL
00458741   1/1  ----------------------------------------------------------------------
00498021   1/1  ----------------------------------------------------------------------
00470751   1/1  ----------------------------------------------------------------------
00383021   1/1  ----------------------------------------------------------------------
00504171   1/1  ----------------------------------------------------------------------
00489211   1/1  ----------------------------------------------------------------------
00520261   1/1  ----------------------------------------------------------------------
00469121   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ----------------------------------------------------------------------
00510711   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:1680
query           KQLATAAATLSMLWETRTYLRRLYGVGFHSMPKESKASAKDLNKSLTKVQGIGGDRLWDAISKTMASLEN
00458741   1/1  ----------------------------------------------------------------------
00498021   1/1  ----------------------------------------------------------------------
00470751   1/1  ----------------------------------------------------------------------
00383021   1/1  ----------------------------------------------------------------------
00504171   1/1  ----------------------------------------------------------------------
00489211   1/1  ----------------------------------------------------------------------
00520261   1/1  ----------------------------------------------------------------------
00469121   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ----------------------------------------------------------------------
00510711   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1750
query           TEGMTRVCREFATLMSIDDELRVAADDDRDGNDSAADFGNMSAMLGATNGSRPSKRRSSVSSGNAPKRPR
00458741   1/1  ----------------------------------------------------------------------
00498021   1/1  ----------------------------------------------------------------------
00470751   1/1  ----------------------------------------------------------------------
00383021   1/1  ----------------------------------------------------------------------
00504171   1/1  ----------------------------------------------------------------------
00489211   1/1  ----------------------------------------------------------------------
00520261   1/1  ----------------------------------------------------------------------
00469121   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ----------------------------------------------------------------------
00510711   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1820
query           QKGRPKNTKKRGSTDSEQDGDFD-----------------------------------------------
00458741   1/1  ----------------------------------------------------------------------
00498021   1/1  ----------------------------------------------------------------------
00470751   1/1  ----------------------------------------------------------------------
00383021   1/1  ----------------------------------------------------------------------
00504171   1/1  ----------------------------------------------------------------------
00489211   1/1  ----------------------------------------------------------------------
00520261   1/1  ----------------------------------------------------------------------
00469121   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00486661   1/1  ----------------------------------------------------------------------
00439581   1/1  ----------------------------------------------------------------------
00510231   1/1  ----------------------------------------------------------------------
00427711   1/1  ----------------------------------------------------------------------
00510711   1/1  ----------------------------------------------------------------------