[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_00781


[Show Plain Result]

## Summary of Sequence Search
   1::335
  71::314  8.4e-35 34.1% 0048666 00486661 1/1   epeat                                   
   5::314  3.9e-24 27.1% 0045874 00458741 1/1   epeat                                   
  18::314  4.6e-23 28.6% 0047075 00470751 1/1   epeat                                   
  10::326  5.4e-22 24.5% 0046912 00469121 1/1   epeat                                   
  18::317  1.3e-18 25.0% 0038302 00383021 1/1   epeat                                   
  28::151  8.4e-17 31.5% 0043958 00439581 1/2   epeat                                   
 204::317  1.2e-15 32.0% 0043958 00439582 2/2   epeat                                   
   3::331  5.8e-14 24.5% 0047335 00473351 1/1   epeat                                   
  10::319  5.9e-14 27.8% 0050416 00504161 1/1   epeat                                   
  15::314    6e-14 25.8% 0051023 00510231 1/1   epeat                                   
  35::300  1.8e-12 21.2% 0040642 00406421 1/1   itellin-phosvitin complex, superhelical 
   8::314  8.7e-12 23.7% 0049802 00498021 1/1   epeat                                   
  19::314    1e-11 27.0% 0042771 00427711 1/1   epeat                                   
  14::314    7e-11 27.5% 0050417 00504171 1/1   epeat                                   
   1::315  2.8e-09 27.1% 0048921 00489211 1/1   epeat                                   
 226::314  1.9e-08 34.5% 0048021 00480212 2/2   epeat                                   
  16::314  9.9e-08 25.8% 0052026 00520261 1/1   epeat                                   
  58::137  0.00011 34.6% 0048021 00480211 1/2   epeat                                   
  19::153  0.00024 26.5% 0051071 00510711 1/2   epeat                                   
 171::314  0.00055 24.6% 0051071 00510712 2/2   epeat                                   
   1::335


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASTIADNADNNGNSKDSVQYLRKVLTSESSPLAQRFRALFSLKHLASSKPPTEETLPAIEAIAAAFSSP
00486661   1/1  ----------------------------------------------------------------------
00458741   1/1  ----laledeellelleellellkskdeevrlsalkaLaeliralgpeedlsellplllkllespd...e
00470751   1/1  -----------------gmrgladlikslrelksleeerkriskelaelrkllksdtpldpskrlealkk
00469121   1/1  ---------ealgslinklgdpellpellplllellkskdeevrkkalealgelakklpdelllalleel
00383021   1/1  -----------------keeeekrieeelaelrellkspdpevrrealkkllylltlgedvsellpellk
00439581   1/2  ---------------------------Lkdpdpevrlaaalalgnl.........gdeavplLlellsde
00439582   2/2  ----------------------------------------------------------------------
00473351   1/1  --eelllkrrnvllqlsdllseleslldllesleelleellrll..qspdpevrlsalkalgellslnnd
00504161   1/1  ---------mednarlknfknkekldleelrrkreefrveiRkkkreellkkkRnislndeeselledll
00510231   1/1  --------------ll.gleellelL..qspdpevrlaallaLgklslgneellellielgliplLlelL
00406421   1/1  ----------------------------------daslllqlpltlkkdgdsipk...ivelllelledp
00498021   1/1  -------asellaellealkskdpdvRlealqeLkkllkkgweelpeedlsellplllkll..sspdpev
00427711   1/1  ------------------lplllkllssp..dwrvReaallalgsiaeglpedllspllpellpallqll
00504171   1/1  -------------MddleqllqllyaspdpevrkqAeeqLeqlqkspefllllleilssssldpevrffA
00489211   1/1  MedeldpldlqqllqlLeallspdnevrkqAeeqLkqlekspdfllllleiladlesldlevrqlAavlL
00480212   2/2  ----------------------------------------------------------------------
00520261   1/1  ---------------PmdleqllqlLqallspdnevrkqAeeqLkeleknnppefllllleilldsssdp
00480211   1/2  ---------------------------------------------------------tgeelvcdllall
00510711   1/2  ------------------lplLlqlLss.spdpevreaalwaLgnlardspearealleagglpaLlell
00510712   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SALLKHELAYCLGQTRNLDTVPHLRKVLEDTQEDAMCRHEAAEALGALGDAGSLDILQRLRDDESEEEVV
00486661   1/1  lkllrleaayalgeigdpgavplLlellkd..edpevrlaaakaLgeigdpealplliell..kdedeev
00458741   1/1  vrklallaLgellkllpelellelllplllkllkspdplvreaalralgsllellpppelledllplllk
00470751   1/1  llyllllgedvsellpellkllsspdpevrrlaylalselaeedpdlllllinlllkllkdpdpev..re
00469121   1/1  lpaLlkllsspdpe.evreaalralaklle.dlpprlalilegilplllkllkdpdpevrraaaraLgnl
00383021   1/1  llsskdfevkrlaylalsllakenpellllvinlllkdlndpnpev..ralAlraLgni.gdpelledll
00439581   1/2  dplvrraaaraLgnlgdeealplllelled..edplvrraAaeaLgnlgdpealplLlell..kdededv
00439582   2/2  ----------------------------------------------------------------------
00473351   1/1  elaeliiesgllpallellsndpdpevrlaallaLgnlasgnpenleplleagalpaLlelLsdp..dpe
00504161   1/1  dlleeleddleelleelpellellnsedpevrlqalkaLgkllssekeelleeliesgllpllvkllksp
00510231   1/1  kdpdpevrlaaaraLgnlaegnpenrealveagalpaLlelLssdp.dpevreaalraLgnlasspelrd
00406421   1/1  dpevkeaaaealgkLvsllrtldleeleplliqllsded....vrrialdaLaaigtpgalkallellks
00498021   1/1  rkaaalaLanlakklde.ellelllplLlkllsspdpevrelalraLasiakrlgpgaaspelveellde
00427711   1/1  ndpnprvraaalwalgrlasklspeglppeflkqllplLlellkd...sprvrsaaasaLgnllellgee
00504171   1/1  ailLknlikknwsslednnalpeeekeeiknsllqllidspplvrnklaqalaeiakrdfpeewpellpd
00489211   1/1  knlikknwpslpeeekeeikelllellkdpdplvrnqaaealaaiarkdgpeewpellpellellsssde
00480212   2/2  ----------------------------------------------------------------------
00520261   1/1  eiRqlAailLknllkknwrptddefaerlwpaldeeekeqiknlllqlllepdplvrsaaaealaaiari
00480211   1/2  ldlaeglrrlaaallgerlgkealpfllrllede..dpevrlaaaealgelgdeaalpallklldDe---
00510711   1/2  kspdpkvrrnaawaLsnlasgdpelrealveagalpaLvellssp..dpevreaaleaLanladsseela
00510712   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RETCDIAVDRILWETSKDSKSEKLKQSDFTSIDPAPPLPLSSAEQSIPELKQILLDASLPLFKRYRAMFA
00486661   1/1  reaaaealgriakdlg.............lfddallpllilllsdedpsvrraaaealgnlgdnfpelve
00458741   1/1  llkdk..dpkvrkaalealgkllellpelllpellplllkllsd..pdpevrkaaleaLgellknlpe..
00470751   1/1  aAlraLgkla....dkelleellpillellssldpdpsvRkaAalaLgnlaeglpdllklvgllplllkl
00469121   1/1  asgdpellealveagllplLlklLsdp..dpevreaaaeaLgnlaedspelrdplleegllpaLlkllkd
00383021   1/1  pallkll...sdpnpyvRkaaalalgklaklnpdlvkdpgllpllvelLsdp..dpsvreaalsaLgela
00439581   1/2  rlaaalaLgnl-----------------------------------------------------------
00439582   2/2  ---------------------------------------------------------------rlaaala
00473351   1/1  vreaalraLgnlakdspelrdalleagilppLlellknlllsdpdpevreaaasalanl...........
00504161   1/1  dpeevrlaalkaLgnlasg..spellealleqgilplLlklLsdpdpevreaalraLgnlasdspelrdp
00510231   1/1  alle.galpaLldlllepllglleklldelskssdpevrraaleaLanl...................ss
00406421   1/1  kelsvleaalallalallprpseellpallellksslvdpdpylrkaaalalgslvrkycvh........
00498021   1/1  llplllsllksdkdpevreaallalakllknlpelleplledllplllkllsdpdpe..vRkaAaealga
00427711   1/1  k...........................................savieagelptsvlspylpellpaLl
00504171   1/1  llqllqspnpelregalliLkelveelrdlllsdelqkrrklllelleedlpeilplllqlledssddvr
00489211   1/1  elregallaLgelleelgsls.esdalqelleeilplllkllsdpd..pevrkaalkalgnlasflpeef
00480212   2/2  ----------------------------------------------------------------------
00520261   1/1  dlpeglwpellplllellkspsdpelreaallalselleelrellqeileellplllkllevllssdpsp
00480211   1/2  ----------------------------------------------------------------------
00510711   1/2  elllelllellgl---------------------------------------------------------
00510712   2/2  ------------------------------pellkellkslevdaellelllellqsde.deevrlaalr


                         -         -         -         +         -         -         -:280
query           LRDMCSPPDLPTAVPAIEALAEGFKDRSALFRHEIAFVFGQLSHPASIPSLVATLSDKNEVGMVRHEAAE
00486661   1/1  ealplllkllkdedpevRraaaeaLgklgd.......eealplLlellkdpdpdvRraaaealgklgsld
00458741   1/1  ....................eelleellplllellkdp..dpevrlaalkaLgalleglpeepllpkllp
00470751   1/1  Lndp..dpeVreaaleaLgnlakdspellkpllegllplLlkllsdpdpeesdydysgvpspwvreaale
00469121   1/1  pd.dpevrraaleaLgnla.snpelreelvlp...................gllpvLlkllkdp..dpev
00383021   1/1  ednpesvllellkgliplLlellndpdpevreaalealgklarsdpeelekllplllkll..sdpnpavr
00439581   1/2  ----------------------------------------------------------------------
00439582   2/2  lgnl........gdeavplLlellsdedplvrraaaraLgnlgdeealplllell..ededplvrraAae
00473351   1/1  ........ardaeprkdapylegllpiLlellkdpdpe..vreaaleaLgnlaegdpeniellveagllp
00504161   1/1  lleegllpallkllkde..dpevrrnaleaLgnlcrgleplddleyvegllplLlellkdpd..pevrea
00510231   1/1  npenrealvelegalpaLlkllkseeedddldpevreaalsaLsnlaydlpeevdenpenleelllegll
00406421   1/1  ........tsscleelvkaivplLiellsd..sdedvrllalkaLgnlghpeslpvllplLpgllslldd
00498021   1/1  llkklpd.......................elleellpallellkedpdpe..vrkaalelLgellesnp
00427711   1/1  ellsrysdenpevreaalealgelvsvsgedllpyidellplllellsdllqkskallelalkdedpelr
00504171   1/1  llalslevrklalkalgsllwidlpeifedlleellelllkllesldplleavdddeeleplekvrkaal
00489211   1/1  edllnellplllellsspdpkvrkaalealgelaerypdflkpylpdllplllklledk..dpevrlaal
00480212   2/2  ---------------tgeelvcdllallldlaeglrrlaaallgerlgkealpfllrllededpevrlaa
00520261   1/1  evrlaalkalgsllrsldsslefeelldqilelllellsdedeevrkaalkcLgrllelypelllpylek
00480211   1/2  ----------------------------------------------------------------------
00510711   1/2  ----------------------------------------------------------------------
00510712   2/2  aLrnlaedpdnaealielgglplLleklLkspdpevreaAaraLgnlasgnpenrealveagalplLlql


                         -         *         -         -         -         -         +:350
query           ALGSLGAEDGVEETLKRFVNDPETVVRDSIIVALDMAEYEKSGEQEYILEQPVAA---------------
00486661   1/1  peaiplLlelLkdedp..eVRkeAaeaLgkig.d------------------------------------
00458741   1/1  lllellsdpspevraaalkalgkllsnlppeill------------------------------------
00470751   1/1  aLgnlaegi...................dpelle------------------------------------
00469121   1/1  reaalkaLgnllsvlpeqplieellplLlkllsdpdpevreaalra------------------------
00383021   1/1  lealkalgnllenpkaleel.................---------------------------------
00439581   1/2  ----------------------------------------------------------------------
00439582   2/2  aLgnlgd.pealplLlellkdededvrlaaalaLgnl---------------------------------
00473351   1/1  llvellsdsdpevreaalraLgnlasgspelleplldlgllplllkllsdp-------------------
00504161   1/1  aleaLgnlaes.npeliealies................-------------------------------
00510231   1/1  palllellkdsdpevreaalralgnlasgspela------------------------------------
00406421   1/1  pslrvRlaAvlaLrnlaehl--------------------------------------------------
00498021   1/1  ellksllpellplllkllsdpdpevrlaalells------------------------------------
00427711   1/1  kaalealgllaaalgpeifapyaeellplllell------------------------------------
00504171   1/1  eclgelaslypsllgpyleqilplllkllqspdl------------------------------------
00489211   1/1  eflstlakq..........................-----------------------------------
00480212   2/2  aealgelgdeaalpallklldDedp..dvRaaAa------------------------------------
00520261   1/1  llelllkllskdedpevrlaaleflsslakseg.------------------------------------
00480211   1/2  ----------------------------------------------------------------------
00510711   1/2  ----------------------------------------------------------------------
00510712   2/2  Lss.spdpevreaalwaLgnlardspearealle------------------------------------