[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_01210


[Show Plain Result]

## Summary of Sequence Search
   1::551
 321::495  8.8e-36 28.3% 0042691 00426911 1/1   nese/Cell cycle control phosphatase     
 324::482  1.4e-34 28.2% 0046064 00460641 1/1   nese/Cell cycle control phosphatase     
 331::474  2.3e-28 27.4% 0038810 00388101 1/1   nese/Cell cycle control phosphatase     
 339::479    1e-23 22.3% 0043853 00438531 1/1   nese/Cell cycle control phosphatase     
 337::475  5.1e-16 26.8% 0049168 00491681 1/1   nese/Cell cycle control phosphatase     
 332::478  3.5e-15 22.4% 0050551 00505511 1/1   nese/Cell cycle control phosphatase     
 342::468  6.6e-14 24.1% 0046433 00464331 1/1   nese/Cell cycle control phosphatase     
 339::468  7.8e-13 24.8% 0044085 00440851 1/1   nese/Cell cycle control phosphatase     
 339::481  3.8e-12 24.6% 0041896 00418961 1/1   nese/Cell cycle control phosphatase     
 343::472  6.4e-12 24.3% 0051401 00514011 1/1   nese/Cell cycle control phosphatase     
 345::482  1.5e-11 19.2% 0049979 00499791 1/1   nese/Cell cycle control phosphatase     
 345::475  1.7e-11 21.6% 0049169 00491691 1/1   nese/Cell cycle control phosphatase     
 340::485  1.6e-10 23.4% 0044241 00442411 1/1   nese/Cell cycle control phosphatase     
 323::473  7.2e-10 18.9% 0051398 00513981 1/1   nese/Cell cycle control phosphatase     
 342::468  7.2e-10 22.9% 0038171 00381711 1/1   nese/Cell cycle control phosphatase     
 342::468  4.7e-09 25.7% 0051400 00514001 1/1   nese/Cell cycle control phosphatase     
 345::464    2e-08 26.7% 0051399 00513991 1/1   nese/Cell cycle control phosphatase     
 342::474  9.9e-08 24.6% 0046432 00464321 1/1   nese/Cell cycle control phosphatase     
 342::461  2.6e-07 25.7% 0049841 00498411 1/1   nese/Cell cycle control phosphatase     
 324::466  4.3e-07 21.3% 0043033 00430331 1/1   nese/Cell cycle control phosphatase     
 350::467  1.7e-06 26.3% 0041897 00418971 1/1   nese/Cell cycle control phosphatase     
 343::459    4e-06 28.6% 0049980 00499801 1/1   nese/Cell cycle control phosphatase     
   1::551


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEQSSPLAAMQPPSVMLRHHFRSEAKAGCSSFPAVRKFGPDSFNFRDLSMKTGHSDYFNTKALRGSSPTV
00426911   1/1  ----------------------------------------------------------------------
00460641   1/1  ----------------------------------------------------------------------
00388101   1/1  ----------------------------------------------------------------------
00438531   1/1  ----------------------------------------------------------------------
00491681   1/1  ----------------------------------------------------------------------
00505511   1/1  ----------------------------------------------------------------------
00464331   1/1  ----------------------------------------------------------------------
00440851   1/1  ----------------------------------------------------------------------
00418961   1/1  ----------------------------------------------------------------------
00514011   1/1  ----------------------------------------------------------------------
00499791   1/1  ----------------------------------------------------------------------
00491691   1/1  ----------------------------------------------------------------------
00442411   1/1  ----------------------------------------------------------------------
00513981   1/1  ----------------------------------------------------------------------
00381711   1/1  ----------------------------------------------------------------------
00514001   1/1  ----------------------------------------------------------------------
00513991   1/1  ----------------------------------------------------------------------
00464321   1/1  ----------------------------------------------------------------------
00498411   1/1  ----------------------------------------------------------------------
00430331   1/1  ----------------------------------------------------------------------
00418971   1/1  ----------------------------------------------------------------------
00499801   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SLAADLSQNFHIDKSPQLATPRRSLFTASLFGPENGRDNMTTPPLPSSSPAPNMEIMDMSPLPHKIPYCH
00426911   1/1  ----------------------------------------------------------------------
00460641   1/1  ----------------------------------------------------------------------
00388101   1/1  ----------------------------------------------------------------------
00438531   1/1  ----------------------------------------------------------------------
00491681   1/1  ----------------------------------------------------------------------
00505511   1/1  ----------------------------------------------------------------------
00464331   1/1  ----------------------------------------------------------------------
00440851   1/1  ----------------------------------------------------------------------
00418961   1/1  ----------------------------------------------------------------------
00514011   1/1  ----------------------------------------------------------------------
00499791   1/1  ----------------------------------------------------------------------
00491691   1/1  ----------------------------------------------------------------------
00442411   1/1  ----------------------------------------------------------------------
00513981   1/1  ----------------------------------------------------------------------
00381711   1/1  ----------------------------------------------------------------------
00514001   1/1  ----------------------------------------------------------------------
00513991   1/1  ----------------------------------------------------------------------
00464321   1/1  ----------------------------------------------------------------------
00498411   1/1  ----------------------------------------------------------------------
00430331   1/1  ----------------------------------------------------------------------
00418971   1/1  ----------------------------------------------------------------------
00499801   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NADLDLDSPTTEISLAKSQQVHAQLSLEDSPMDLEPPGRPQRHKPPILRPSLMRSKAYSSGDKGSLAPQP
00426911   1/1  ----------------------------------------------------------------------
00460641   1/1  ----------------------------------------------------------------------
00388101   1/1  ----------------------------------------------------------------------
00438531   1/1  ----------------------------------------------------------------------
00491681   1/1  ----------------------------------------------------------------------
00505511   1/1  ----------------------------------------------------------------------
00464331   1/1  ----------------------------------------------------------------------
00440851   1/1  ----------------------------------------------------------------------
00418961   1/1  ----------------------------------------------------------------------
00514011   1/1  ----------------------------------------------------------------------
00499791   1/1  ----------------------------------------------------------------------
00491691   1/1  ----------------------------------------------------------------------
00442411   1/1  ----------------------------------------------------------------------
00513981   1/1  ----------------------------------------------------------------------
00381711   1/1  ----------------------------------------------------------------------
00514001   1/1  ----------------------------------------------------------------------
00513991   1/1  ----------------------------------------------------------------------
00464321   1/1  ----------------------------------------------------------------------
00498411   1/1  ----------------------------------------------------------------------
00430331   1/1  ----------------------------------------------------------------------
00418971   1/1  ----------------------------------------------------------------------
00499801   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PPFRFAAGSSKPTACSSLSLSEMFEQSPPRESSPRFLTSISMGPPRPRAPFSGVVGQCRSNGSPVNGIRK
00426911   1/1  ----------------------------------------------------------------------
00460641   1/1  ----------------------------------------------------------------------
00388101   1/1  ----------------------------------------------------------------------
00438531   1/1  ----------------------------------------------------------------------
00491681   1/1  ----------------------------------------------------------------------
00505511   1/1  ----------------------------------------------------------------------
00464331   1/1  ----------------------------------------------------------------------
00440851   1/1  ----------------------------------------------------------------------
00418961   1/1  ----------------------------------------------------------------------
00514011   1/1  ----------------------------------------------------------------------
00499791   1/1  ----------------------------------------------------------------------
00491691   1/1  ----------------------------------------------------------------------
00442411   1/1  ----------------------------------------------------------------------
00513981   1/1  ----------------------------------------------------------------------
00381711   1/1  ----------------------------------------------------------------------
00514001   1/1  ----------------------------------------------------------------------
00513991   1/1  ----------------------------------------------------------------------
00464321   1/1  ----------------------------------------------------------------------
00498411   1/1  ----------------------------------------------------------------------
00430331   1/1  ----------------------------------------------------------------------
00418971   1/1  ----------------------------------------------------------------------
00499801   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SSNPFCRPRKQSRRSLSMFEHPEDIVNQEEDTIMSSPGLQPIADIDSQPTLQLPHFIPEDGPDQLPRVES
00426911   1/1  ----------------------------------------mlvllikdllvllllllvspllsglkyisp
00460641   1/1  -------------------------------------------llllllvlllllllvlallagvklisp
00388101   1/1  --------------------------------------------------pllalalvvallddvklisp
00438531   1/1  ----------------------------------------------------------iealssvklisa
00491681   1/1  --------------------------------------------------------lpellpg..plisp
00505511   1/1  ---------------------------------------------------llalivavaalagvplisa
00464331   1/1  -------------------------------------------------------------sglltalls
00440851   1/1  ----------------------------------------------------------lpllsvvklisp
00418961   1/1  ----------------------------------------------------------vvkmsllllvsa
00514011   1/1  --------------------------------------------------------------llllllvl
00499791   1/1  ----------------------------------------------------------------tvklis
00491691   1/1  ----------------------------------------------------------------alvlaa
00442411   1/1  -----------------------------------------------------------llanlvllvsa
00513981   1/1  ------------------------------------------lllalllvvplyfallaellagvptisa
00381711   1/1  -------------------------------------------------------------lsvvklisp
00514001   1/1  -------------------------------------------------------------lssvplisp
00513991   1/1  ----------------------------------------------------------------vplisa
00464321   1/1  -------------------------------------------------------------ftalldpvl
00498411   1/1  -------------------------------------------------------------lnpsllvsa
00430331   1/1  -------------------------------------------vilvlllvgglaawlaaalpvvklisp
00418971   1/1  ---------------------------------------------------------------------a
00499801   1/1  --------------------------------------------------------------lpsllvsa


                         -         -         -         -         *         -         -:420
query           SVLVDIINGKYNDCYDKIMIIDCRFEYEYEGGHINGAVNYTDKEHLAAELFDQEPKPSTALIFHCEYSAH
00426911   1/1  eelkallesglsslledvvliDvRspeeyeggHipgAiniplsellerelletllalleldkdkpivvyC
00460641   1/1  eelaellddglsdlledvvliDvRspeeyeggHipGAinipl.dellerllelllallgldkdkpvvvyC
00388101   1/1  eellellesg....gedvlllDvRppeeYeggHIpgAiniplpelllrrlkfdllllllllspeeleell
00438531   1/1  eelaellddg......dvvlvDvRepeeyagghipgAinipl.deleerlgellpgidkdkpvvvycgsg
00491681   1/1  eelaelldsglld..pdvvllDvRsadrflgeepaeyaaghipgAvnipldtlldpdgplphllpspeel
00505511   1/1  eeLkallddpn....dsvlllDvRspdeyekghIpgAvniplsqlllrrsdgtleslleleellallgid
00464331   1/1  vvplispeelaallddg......dvvllDvRspaefageglldlraghipgAinipldtlldgdglllsp
00440851   1/1  eelaellddg.......vvllDvRepeeyagghipgAvniplgellerglllspeeleallg.gldkdkp
00418961   1/1  eelaalld........dvvlvDarsalrflgegpaeyraghIpgAvnlpldellddlllsspldgtlpsp
00514011   1/1  llllllllaalaavplisaeelaallddgd....edvvllDvRepeeyaaghipgAvnipl.gelearlg
00499791   1/1  peellelldd......gdvvliDvRsalrdflglpepeeyaaghipgAinipldelldadgplphmlpsa
00491691   1/1  lnvvllispeelkellddg......dvvliDvRspeeflglvpeprleelaaghipgAinipldellddd
00442411   1/1  eellallddg......dvvllDvrepeelyagghIpgAvnipldalldddgrhtlpspeelaallgelgi
00513981   1/1  eelaallddg.....edavllDvRepeefaaghipgainipl.gelearlaellpdkdkpivvycas.gv
00381711   1/1  eelaellddg......davllDvRepeeyaaghipgAvnipl..deleerlgel.dkdkpvvvyc.rsgv
00514001   1/1  aelaelladg......dvvllDvrepaeyaaghipgAvnlpldella...rllgldkdkpvvvycg.sgv
00513991   1/1  eelaallddg.....edvvllDvRepeefaaghipgavnipl.delearlaelgidkdkpvvvycg.sgv
00464321   1/1  lvsaeelaallddg......dvvllDvRspaeyagghipgAvnlpl.delldrldelpgtlpspeelaal
00498411   1/1  eellellddg......dvvllDvRspeeflgevllldpglglaayaaghipgAvnipldelldadgtlps
00430331   1/1  eelaellddg.....pdvvllDvRepeeyaaghipgAvniplgel...eeflaelaalgidkdkpvvvyc
00418971   1/1  eellallddp......dvvllDvrsaleflgeveegrplyraghIpgAvnipldellddsdldgtlpspe
00499801   1/1  eellellddg......dvvllDvrspeeflgeveelraalraghipgAvnipldellddgtlpspeelaa


                         -         -         +         -         -         -         -:490
query           RAPIMAKYIRHRDRAVNVDIYPKLTYPEMYILNGGYSSFFAEHRALCYPQNYVEMSAKEHEFACERGLGK
00426911   1/1  efsgvrsakaaalLreldraln..lypklGytnvyvLdGGykaWraaglplcegksyvpdldvavpveil
00460641   1/1  efsgvrsakaarlLrkllraln..lypllGypnvyvLdGGykaWraaglplvegesyvfmld--------
00388101   1/1  .lgldkdkpvvvycesgsrsapalasllr...lllaalalkklGy.nvylLdGG----------------
00438531   1/1  vrsgpklarllr....araalalralGyknvyvLdGGfsaWlaaglpvetgvgvpppll-----------
00491681   1/1  aellaelgidkdkpvvvycrsslgvrlaaraalllralG............fenv---------------
00505511   1/1  kdkpvvlycgsgvraalaldstlrllalalkllgyktllrsdvyvLdGGyeaWsaagl------------
00464331   1/1  eelaellaelgldkdkpvvvycr.sgvrsaraalllrelG........----------------------
00440851   1/1  vvvyc.rsgvrsaraalllrelG............fenvylldGGlla----------------------
00418961   1/1  eelaallgelgidkdkpvvvycgsgglvrAaraawalr............llGh.dvyvLd---------
00514011   1/1  elgidkdkpivvycr.sgvrsalaaalLrelG............f.nvynld------------------
00499791   1/1  eeleellaelgidkdkpivvyCgsgvrssaraalalrllG............fknvyvLdGG--------
00491691   1/1  gtlpspeeleellselgidkdkpivvyCg.sgvrsaraalalkelG.........---------------
00442411   1/1  dkdkpvvvycgsglvrAaraawalrll............GyknvrvldGGlsaWlaaglpvetgv-----
00513981   1/1  rsalaaalLrka............GfdnlvynleGGilaWraaglpvvkgksl-----------------
00381711   1/1  rsalaalllrel............GfenvyvldgGilaWlaaglplvs----------------------
00514001   1/1  raaraawllral............GfdnvyvLdGGlaaWkaaglpvet----------------------
00513991   1/1  rsaraalllral............GyenvyvldgGlsaWlaagl--------------------------
00464321   1/1  lgalgidkdkpvvvydcgsgvraaraawllrll............Gfenvyvld----------------
00498411   1/1  peelaellaelgidkdkpvvvycgs.gvrsalaalallrll-----------------------------
00430331   1/1  rs.gvrsaraalllrel............GfenvynldgGilaWla------------------------
00418971   1/1  elaellgalgidndeeadlkpvvvycg.sgvrAaraawalrll....-----------------------
00499801   1/1  llaelgidkdkpvvvycg.sgvraaraalalrll.....-------------------------------


                         *         -         -         -         -         +         -:560
query           VKQRSKLSRAQTFAFGQNSLQIEESPTGRCRPVGDRSCDPDAPFDRDVEVTRLPGRRMFSY---------
00426911   1/1  pgltl-----------------------------------------------------------------
00460641   1/1  ----------------------------------------------------------------------
00388101   1/1  ----------------------------------------------------------------------
00438531   1/1  ----------------------------------------------------------------------
00491681   1/1  ----------------------------------------------------------------------
00505511   1/1  ----------------------------------------------------------------------
00464331   1/1  ----------------------------------------------------------------------
00440851   1/1  ----------------------------------------------------------------------
00418961   1/1  ----------------------------------------------------------------------
00514011   1/1  ----------------------------------------------------------------------
00499791   1/1  ----------------------------------------------------------------------
00491691   1/1  ----------------------------------------------------------------------
00442411   1/1  ----------------------------------------------------------------------
00513981   1/1  ----------------------------------------------------------------------
00381711   1/1  ----------------------------------------------------------------------
00514001   1/1  ----------------------------------------------------------------------
00513991   1/1  ----------------------------------------------------------------------
00464321   1/1  ----------------------------------------------------------------------
00498411   1/1  ----------------------------------------------------------------------
00430331   1/1  ----------------------------------------------------------------------
00418971   1/1  ----------------------------------------------------------------------
00499801   1/1  ----------------------------------------------------------------------