[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_01225


[Show Plain Result]

## Summary of Sequence Search
   1::252
 110::226  2.6e-23 38.6% 0047108 00471081 1/1   inding domain, RBD                      
  79::197  1.9e-22 34.2% 0047197 00471971 1/1   inding domain, RBD                      
  75::215  1.2e-21 28.3% 0049801 00498011 1/1   inding domain, RBD                      
 107::195    8e-20 36.0% 0050839 00508391 1/1   inding domain, RBD                      
 116::192  8.5e-20 38.2% 0049843 00498431 1/1   inding domain, RBD                      
 108::222  8.6e-20 37.5% 0046785 00467851 1/1   inding domain, RBD                      
  89::192    9e-20 33.0% 0047631 00476311 1/1   inding domain, RBD                      
  98::195  1.2e-19 34.7% 0052231 00522311 1/1   inding domain, RBD                      
  98::195  2.4e-19 33.7% 0052229 00522291 1/1   inding domain, RBD                      
  98::199  3.8e-19 35.6% 0052236 00522361 1/1   inding domain, RBD                      
  96::195  4.6e-19 33.3% 0050803 00508031 1/1   inding domain, RBD                      
 101::205  7.4e-19 33.0% 0050515 00505151 1/1   inding domain, RBD                      
 110::194  8.2e-19 37.6% 0037834 00378341 1/1   inding domain, RBD                      
 102::195  8.3e-19 34.0% 0041653 00416531 1/1   inding domain, RBD                      
  98::211  8.4e-19 32.4% 0050466 00504661 1/1   inding domain, RBD                      
 117::192    9e-19 40.0% 0047422 00474221 1/1   inding domain, RBD                      
 103::195  1.3e-18 34.4% 0049492 00494921 1/1   inding domain, RBD                      
 109::220  1.4e-18 35.2% 0049416 00494161 1/1   inding domain, RBD                      
 108::195  1.6e-18 39.5% 0052243 00522431 1/1   inding domain, RBD                      
 107::195  1.8e-18 37.1% 0048682 00486821 1/1   inding domain, RBD                      
 111::195  2.4e-18 37.6% 0050837 00508371 1/1   inding domain, RBD                      
 112::209  2.8e-18 35.1% 0052240 00522401 1/1   inding domain, RBD                      
 108::211  2.9e-18 38.5% 0048680 00486801 1/1   inding domain, RBD                      
 113::225  2.9e-18 36.4% 0052622 00526221 1/1   inding domain, RBD                      
 111::195  3.4e-18 34.1% 0052238 00522381 1/1   inding domain, RBD                      
 114::195  4.1e-18 36.6% 0045893 00458931 1/1   inding domain, RBD                      
 101::195  4.3e-18 35.5% 0050577 00505771 1/1   inding domain, RBD                      
 118::189  4.8e-18 38.9% 0050806 00508061 1/1   inding domain, RBD                      
 108::195  5.1e-18 33.0% 0052221 00522211 1/1   inding domain, RBD                      
  98::195  5.6e-18 37.1% 0050834 00508341 1/1   inding domain, RBD                      
 115::195  5.7e-18 37.0% 0046287 00462871 1/1   inding domain, RBD                      
 110::240  6.4e-18 26.9% 0049769 00497691 1/1   inding domain, RBD                      
 117::192    7e-18 40.0% 0047172 00471721 1/1   inding domain, RBD                      
 115::195  9.2e-18 39.5% 0053313 00533131 1/1   inding domain, RBD                      
 108::195  1.1e-17 39.5% 0052245 00522451 1/1   inding domain, RBD                      
 114::195  1.1e-17 36.6% 0046876 00468761 1/1   inding domain, RBD                      
  99::195  1.2e-17 32.6% 0046794 00467941 1/1   inding domain, RBD                      
 112::195  1.2e-17 38.1% 0046286 00462861 1/1   inding domain, RBD                      
 114::226  1.3e-17 34.3% 0048984 00489841 1/1   inding domain, RBD                      
 117::195  1.5e-17 38.2% 0052441 00524411 1/1   inding domain, RBD                      
 112::195  2.3e-17 38.1% 0052218 00522181 1/1   inding domain, RBD                      
 112::195  2.4e-17 37.3% 0052899 00528991 1/1   inding domain, RBD                      
 117::192  2.4e-17 38.7% 0045373 00453731 1/1   inding domain, RBD                      
 107::192  2.8e-17 37.2% 0052248 00522481 1/1   inding domain, RBD                      
 103::192  2.9e-17 40.0% 0045479 00454791 1/1   inding domain, RBD                      
 108::206  2.9e-17 34.3% 0050566 00505661 1/1   inding domain, RBD                      
 108::195  2.9e-17 36.4% 0050809 00508091 1/1   inding domain, RBD                      
 105::195  3.3e-17 39.5% 0052235 00522351 1/1   inding domain, RBD                      
 116::195  4.1e-17 40.0% 0046220 00462201 1/1   inding domain, RBD                      
 108::195  4.3e-17 36.4% 0052232 00522321 1/1   inding domain, RBD                      
 115::195  6.7e-17 34.6% 0052897 00528971 1/1   inding domain, RBD                      
  97::192  7.5e-17 34.8% 0052442 00524421 1/1   inding domain, RBD                      
 110::195  8.5e-17 37.3% 0050802 00508021 1/1   inding domain, RBD                      
 105::233  9.7e-17 27.7% 0042061 00420611 1/1   inding domain, RBD                      
 118::195  1.2e-16 38.5% 0052219 00522191 1/1   inding domain, RBD                      
  98::195  1.3e-16 33.7% 0050808 00508081 1/1   inding domain, RBD                      
 108::190  1.6e-16 32.5% 0052222 00522221 1/1   inding domain, RBD                      
 101::202  2.2e-16 32.3% 0050514 00505141 1/1   inding domain, RBD                      
 116::194  2.8e-16 37.2% 0048400 00484001 1/1   inding domain, RBD                      
 105::209  2.9e-16 36.9% 0049334 00493341 1/1   inding domain, RBD                      
 118::195  3.3e-16 42.3% 0050838 00508381 1/1   inding domain, RBD                      
 106::195  3.7e-16 36.0% 0042860 00428601 1/1   inding domain, RBD                      
 106::229  5.1e-16 28.8% 0050567 00505671 1/1   inding domain, RBD                      
 111::198  5.3e-16 38.5% 0050479 00504791 1/1   inding domain, RBD                      
 101::205  5.6e-16 33.3% 0050478 00504781 1/1   inding domain, RBD                      
 112::204  5.7e-16 35.6% 0045747 00457471 1/1   inding domain, RBD                      
 108::195  6.1e-16 38.4% 0036165 00361651 1/1   inding domain, RBD                      
 107::189  7.2e-16 33.7% 0052239 00522391 1/1   inding domain, RBD                      
 117::194  8.7e-16 36.4% 0049775 00497751 1/1   inding domain, RBD                      
  96::195  1.3e-15 31.9% 0052234 00522341 1/1   inding domain, RBD                      
 106::209  1.6e-15 37.5% 0051748 00517481 1/1   inding domain, RBD                      
 100::195  1.9e-15 34.1% 0046795 00467951 1/1   inding domain, RBD                      
 108::195  3.8e-15 35.4% 0052217 00522171 1/1   inding domain, RBD                      
 111::195  4.1e-15 36.4% 0052082 00520821 1/1   inding domain, RBD                      
  89::195  4.2e-15 29.3% 0050480 00504801 1/1   inding domain, RBD                      
 108::211  5.9e-15 32.4% 0052230 00522301 1/1   inding domain, RBD                      
 101::195  6.9e-15 33.7% 0049888 00498881 1/1   inding domain, RBD                      
  99::195  8.4e-15 34.1% 0050568 00505681 1/1   inding domain, RBD                      
 116::193  8.7e-15 38.7% 0052898 00528981 1/1   inding domain, RBD                      
 108::195  1.2e-14 36.6% 0052223 00522231 1/1   inding domain, RBD                      
 101::195    5e-14 34.5% 0050481 00504811 1/1   inding domain, RBD                      
 101::208  6.3e-14 29.4% 0050476 00504761 1/1   inding domain, RBD                      
 115::195  9.2e-14 34.7% 0052244 00522441 1/1   inding domain, RBD                      
 111::194  1.5e-13 33.3% 0050477 00504771 1/1   inding domain, RBD                      
 108::192  2.5e-13 38.0% 0052233 00522331 1/1   inding domain, RBD                      
 111::205  3.7e-13 32.9% 0050512 00505121 1/1   inding domain, RBD                      
  98::192  3.8e-13 32.6% 0050807 00508071 1/1   inding domain, RBD                      
 120::195  7.5e-13 37.0% 0052429 00524291 1/1   inding domain, RBD                      
 108::209  7.9e-13 30.5% 0050804 00508041 1/1   inding domain, RBD                      
 101::208  9.7e-13 28.0% 0050565 00505651 1/1   inding domain, RBD                      
 118::195  3.9e-12 38.0% 0050576 00505761 1/1   inding domain, RBD                      
 108::195  2.5e-11 31.6% 0050805 00508051 1/1   inding domain, RBD                      
 112::199  1.8e-09 32.5% 0050727 00507271 1/1   inding domain, RBD                      
 115::182  0.00011 22.1% 0044542 00445421 1/1   inding domain, RBD                      
   1::252


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDPETEAQIAQWQSAYMSKDESNQIAASNGKAGVGRRDDASSATGANTGPLGNIQRLQDGSTISTPPSVA
00471081   1/1  ----------------------------------------------------------------------
00471971   1/1  ----------------------------------------------------------------------
00498011   1/1  ----------------------------------------------------------------------
00508391   1/1  ----------------------------------------------------------------------
00498431   1/1  ----------------------------------------------------------------------
00467851   1/1  ----------------------------------------------------------------------
00476311   1/1  ----------------------------------------------------------------------
00522311   1/1  ----------------------------------------------------------------------
00522291   1/1  ----------------------------------------------------------------------
00522361   1/1  ----------------------------------------------------------------------
00508031   1/1  ----------------------------------------------------------------------
00505151   1/1  ----------------------------------------------------------------------
00378341   1/1  ----------------------------------------------------------------------
00416531   1/1  ----------------------------------------------------------------------
00504661   1/1  ----------------------------------------------------------------------
00474221   1/1  ----------------------------------------------------------------------
00494921   1/1  ----------------------------------------------------------------------
00494161   1/1  ----------------------------------------------------------------------
00522431   1/1  ----------------------------------------------------------------------
00486821   1/1  ----------------------------------------------------------------------
00508371   1/1  ----------------------------------------------------------------------
00522401   1/1  ----------------------------------------------------------------------
00486801   1/1  ----------------------------------------------------------------------
00526221   1/1  ----------------------------------------------------------------------
00522381   1/1  ----------------------------------------------------------------------
00458931   1/1  ----------------------------------------------------------------------
00505771   1/1  ----------------------------------------------------------------------
00508061   1/1  ----------------------------------------------------------------------
00522211   1/1  ----------------------------------------------------------------------
00508341   1/1  ----------------------------------------------------------------------
00462871   1/1  ----------------------------------------------------------------------
00497691   1/1  ----------------------------------------------------------------------
00471721   1/1  ----------------------------------------------------------------------
00533131   1/1  ----------------------------------------------------------------------
00522451   1/1  ----------------------------------------------------------------------
00468761   1/1  ----------------------------------------------------------------------
00467941   1/1  ----------------------------------------------------------------------
00462861   1/1  ----------------------------------------------------------------------
00489841   1/1  ----------------------------------------------------------------------
00524411   1/1  ----------------------------------------------------------------------
00522181   1/1  ----------------------------------------------------------------------
00528991   1/1  ----------------------------------------------------------------------
00453731   1/1  ----------------------------------------------------------------------
00522481   1/1  ----------------------------------------------------------------------
00454791   1/1  ----------------------------------------------------------------------
00505661   1/1  ----------------------------------------------------------------------
00508091   1/1  ----------------------------------------------------------------------
00522351   1/1  ----------------------------------------------------------------------
00462201   1/1  ----------------------------------------------------------------------
00522321   1/1  ----------------------------------------------------------------------
00528971   1/1  ----------------------------------------------------------------------
00524421   1/1  ----------------------------------------------------------------------
00508021   1/1  ----------------------------------------------------------------------
00420611   1/1  ----------------------------------------------------------------------
00522191   1/1  ----------------------------------------------------------------------
00508081   1/1  ----------------------------------------------------------------------
00522221   1/1  ----------------------------------------------------------------------
00505141   1/1  ----------------------------------------------------------------------
00484001   1/1  ----------------------------------------------------------------------
00493341   1/1  ----------------------------------------------------------------------
00508381   1/1  ----------------------------------------------------------------------
00428601   1/1  ----------------------------------------------------------------------
00505671   1/1  ----------------------------------------------------------------------
00504791   1/1  ----------------------------------------------------------------------
00504781   1/1  ----------------------------------------------------------------------
00457471   1/1  ----------------------------------------------------------------------
00361651   1/1  ----------------------------------------------------------------------
00522391   1/1  ----------------------------------------------------------------------
00497751   1/1  ----------------------------------------------------------------------
00522341   1/1  ----------------------------------------------------------------------
00517481   1/1  ----------------------------------------------------------------------
00467951   1/1  ----------------------------------------------------------------------
00522171   1/1  ----------------------------------------------------------------------
00520821   1/1  ----------------------------------------------------------------------
00504801   1/1  ----------------------------------------------------------------------
00522301   1/1  ----------------------------------------------------------------------
00498881   1/1  ----------------------------------------------------------------------
00505681   1/1  ----------------------------------------------------------------------
00528981   1/1  ----------------------------------------------------------------------
00522231   1/1  ----------------------------------------------------------------------
00504811   1/1  ----------------------------------------------------------------------
00504761   1/1  ----------------------------------------------------------------------
00522441   1/1  ----------------------------------------------------------------------
00504771   1/1  ----------------------------------------------------------------------
00522331   1/1  ----------------------------------------------------------------------
00505121   1/1  ----------------------------------------------------------------------
00508071   1/1  ----------------------------------------------------------------------
00524291   1/1  ----------------------------------------------------------------------
00508041   1/1  ----------------------------------------------------------------------
00505651   1/1  ----------------------------------------------------------------------
00505761   1/1  ----------------------------------------------------------------------
00508051   1/1  ----------------------------------------------------------------------
00507271   1/1  ----------------------------------------------------------------------
00445421   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QTTSTTPIPGQPNAPNQSGPGKTVMRSGGGQTWTDSTLLEWDPAHFRLFCGNLAGEVTDDSLLKAFSKYP
00471081   1/1  ---------------------------------------lllllleelellllvllllllllpallppea
00471971   1/1  --------leerddddtgrsrgygfvefssesggesasralsglnglslggrslkvgpsppspspeeppp
00498011   1/1  ----ldallalnglllagrlllvgpsllgkalslplaslpsedppsrtlfVgnLppdvteedLrelFskf
00508391   1/1  ------------------------------------llgledepsrtlfvgnLppdvteedLrelfskfg
00498431   1/1  ---------------------------------------------rtlfvgnLpfdvteedLrelfskfg
00467851   1/1  -------------------------------------lpeedppsrtlfVgnLppdvteedllelLrelF
00476311   1/1  ------------------sglllllglllgpasssgllsersrdsttlfvgnLpfdvteedLkelfskfG
00522311   1/1  ---------------------------llllglgsssspeeeppsrtlfvgnLppdvteedLrelFskfG
00522291   1/1  ---------------------------lgllglgsssspsesppsrtlfvgnLppdvteedLrelfskfG
00522361   1/1  ---------------------------rsglglllsllseesppsrtlfvgnLppdvteedLrelfskfG
00508031   1/1  -------------------------lglllssslssslseeerpsrtlfvgnLpfdvteedLrelFskfG
00505151   1/1  ------------------------------sslsslslplelrpsrtlfvgnLppdvteedLrelFskfG
00378341   1/1  ---------------------------------------eedrssrtlfvgnLppdvteedLrelfskfg
00416531   1/1  -------------------------------gppssllsleprssrtlfvgnlpydvteedLrelfskfG
00504661   1/1  ---------------------------eglsslsslslpselrpsrtlfvgnLppdvteedLrelFskfG
00474221   1/1  ----------------------------------------------tlfvgnLpldvteedLrelfskfg
00494921   1/1  --------------------------------lgslslgsesppsrtlfvgnLppdvteedLrelfskfG
00494161   1/1  --------------------------------------ledpppsrtlfVgnLpydvteedLrelFskfG
00522431   1/1  -------------------------------------lleesrdsrtlfvgnLpfdvteedLrelFskfg
00486821   1/1  ------------------------------------llgledppsrtlfvgnLppdvteedLrelfskfG
00508371   1/1  ----------------------------------------ldppsrtlfvgnLppdvteedLrelfskfg
00522401   1/1  -----------------------------------------ldssledlpsrtlfVgnLppdvteedLre
00486801   1/1  -------------------------------------lpeedppsrtlfvgnLppdvteedLrelfskfG
00526221   1/1  ------------------------------------------llelppsrtlfvgnLpydvteedLrelF
00522381   1/1  ----------------------------------------llepsrtlfvgnLppdvteedLrelfskfg
00458931   1/1  -------------------------------------------psrtlfvgnLppdvteedLrelfskfg
00505771   1/1  ------------------------------lssgssslssesrpsrtlfvgnLpydvteedLrelFskfg
00508061   1/1  -----------------------------------------------lfvgnLppdvteedLrelfskfg
00522211   1/1  -------------------------------------spsesrssrtlfvgnLppdvteedLrelFskfG
00508341   1/1  ---------------------------lllaglgssslgeedppsrtlfvgnLppdvteedLrelFskfG
00462871   1/1  --------------------------------------------srtlfvgnLppdvteedLrelfskfg
00497691   1/1  ---------------------------------------lapepsrtlfVgnLppdvteedLrelFskfG
00471721   1/1  ----------------------------------------------tlfvgnLpldvteedLrelfskfg
00533131   1/1  --------------------------------------------srtlfvgnLpldvteedLrelfskfg
00522451   1/1  -------------------------------------lgledppsrtlfvgnLppdvteedLrelfskfg
00468761   1/1  -------------------------------------------psrtlfvgnLppdvteedLrelfskfg
00467941   1/1  ----------------------------lllllslsllgeesrpsrtlfVgnLppdvteedLrelFskfg
00462861   1/1  -----------------------------------------dppsrtlfvgnLppdvteedLrelfskfg
00489841   1/1  -------------------------------------------lpsrtlfvgnLppdlvteedLrelFsk
00524411   1/1  ----------------------------------------------lrrlfVgnLpfdvteeeLrelFsk
00522181   1/1  -----------------------------------------gleedpdsttlfvgnLpfdvteedLrelF
00528991   1/1  -----------------------------------------dresrtlfvgnLppdvlteedLrelfskf
00453731   1/1  ----------------------------------------------tlfvgnLpldvteedLrelfskfg
00522481   1/1  ------------------------------------llgsessssttlfvgnLpfdvteedLrelfskfg
00454791   1/1  --------------------------------pgssslgsedppsrtlfvgnLppdvteedLrelfskfG
00505661   1/1  -------------------------------------slsesppsrtlfvgnLppdvteedLrelfskfG
00508091   1/1  -------------------------------------lseedlesrtlfvgnLpfdvteedLrelfskfG
00522351   1/1  ----------------------------------llllpeldppsrtlfvgnLppdvteedLrelFskfG
00462201   1/1  ---------------------------------------------rtlfvgnLppdvteedLrelfskfg
00522321   1/1  -------------------------------------gpledppsrtlfvgnLppdvteedLrelfskfg
00528971   1/1  --------------------------------------------sttlfvgnLppsvteedLrelfskfg
00524421   1/1  --------------------------gaaelllptrvllldnmvltrlyvgnlpydvteedlrelfskfG
00508021   1/1  ---------------------------------------lllagllslelpdsrtlfVgnLppdvteedL
00420611   1/1  ----------------------------------knesgaellpsttlfvgnlppdvteedLkelFskfG
00522191   1/1  -----------------------------------------------lfvgnLppdvteedLrelfskfg
00508081   1/1  ---------------------------lllslsgssllseepppsrtlfvgnLppdvteedLrelfskfG
00522221   1/1  -------------------------------------lsvesldsttlfVgnLpldvteedLlelrelfs
00505141   1/1  ------------------------------sgsllsllslelrpsrtlfvgnLppdvteedLrelfskfG
00484001   1/1  ---------------------------------------------rtlfvgnLpfdvteedLrelfskfg
00493341   1/1  ----------------------------------lllelsedlssrtlfvgnLpfdvteedLrelFskfG
00508381   1/1  -----------------------------------------------lfvgnLppdvteedLrelfskfg
00428601   1/1  -----------------------------------gssssseppsrtlfvgnLppdvteedLrelfskfg
00505671   1/1  -----------------------------------glspseerpsrtlfVgnLppdvteedLrelFskfG
00504791   1/1  ----------------------------------------ldrssrtlfvgnLppdvteedLrelFskfG
00504781   1/1  ------------------------------lslgssgsssssresrtlfvgnLpysateedlrelFskfg
00457471   1/1  -----------------------------------------lppsrtlfvgnLppdvteedlkelLrelf
00361651   1/1  -------------------------------------sseedlpsrtlfvgnLppdvteedLrelfskfG
00522391   1/1  ------------------------------------dssleslpsrtlfvgnLppdvteedLrelfskfg
00497751   1/1  ----------------------------------------------lrtlyVgnLpfdvteedLrelFsk
00522341   1/1  -------------------------lllllldppslllssepppsrtlfvgnLppdvteedLrelFskfG
00517481   1/1  -----------------------------------sslslalppsrtlfVgnLppdvteedLrelfskfG
00467951   1/1  -----------------------------llglsssslseeerpsrtlfvgnLpfdvteedLrelfskfg
00522171   1/1  -------------------------------------dssllppsrtlfvgnLppdvteedLrelfskfg
00520821   1/1  ----------------------------------------ldresrtlfvgnlp..vteedLrelfskfg
00504801   1/1  ------------------llnglllggrplrvspalpspspdppsrtlfVgnLplpdvteedLrelFskf
00522301   1/1  -------------------------------------sssessssttlfvgnLpfsvteedLrelFskfg
00498881   1/1  ------------------------------gssgssvsgslgppsrtlfVgnlppdvteesllledlled
00505681   1/1  ----------------------------lllgggsslsssasppsrtlfVgnLppdvteedLrelFskfG
00528981   1/1  ---------------------------------------------ttlfvgnLplsvteedLrelFskfg
00522231   1/1  -------------------------------------lgeesppsrtlfvgnLppdvteedLrelfskfG
00504811   1/1  ------------------------------llsgssslssesrpsrtlfVgnLppedvteedLrelFskf
00504761   1/1  ------------------------------gssgssgspsesppsrtlfvgnLppdvteedLrelfskfG
00522441   1/1  --------------------------------------------sttlfvgnLppdvteedLrelfskfg
00504771   1/1  ----------------------------------------lsspsttLfvgnLppevflldeteedleel
00522331   1/1  -------------------------------------llsegppsrtlfvgnLppdvteeeLrelfspfG
00505121   1/1  ----------------------------------------lsssstrlfvgnLpfdvteeeLrelfskfg
00508071   1/1  ---------------------------lgslgspssllsleslpsrtlyvgnLpydlvteeeLrelfspf
00524291   1/1  -------------------------------------------------VgnLpldvteedLkelfskyg
00508041   1/1  -------------------------------------lgpsrrsgtrlfVgnLppdvteedLkdlfskfG
00505651   1/1  ------------------------------lssgslgspeesppsrvlfvgnlpkevteedLrelFskfG
00505761   1/1  -----------------------------------------------lfvgnLpfdvteedLrelfskfg
00508051   1/1  -------------------------------------ssselepsrvlfvgnlpydlvteedLrelfspf
00507271   1/1  -----------------------------------------dldsttvfvgnlppslt.eellelfskfG
00445421   1/1  --------------------------------------------lsklvirnLPptlteeellellsplg


                         +         -         -         -         -         *         -:210
query           SVQKARVIRDKRTEKSKGYGFVSFSDGEDYFRAAREMQGKYIGSHPVLLRRAMTEIRPVVVGKGGAKGHK
00471081   1/1  dppsrtlfVgnLppdvteedLrelFskfGevksvkivrdketgkskgfafVeFeseedAekAlealngke
00471971   1/1  srtlfvgnLppdvteedLrelFskfGevvsvrivrdkntgkskGfafVeFeseedAe-------------
00498011   1/1  GevvsvrivrdkntgkskGfafVeFeseedAekAlealngkelggrplrvelakpkpkrrkrggglgggg
00508391   1/1  evvsvrlvrdketgkskgfafVeFeseedaekalealngteldgrplrvelakpk---------------
00498431   1/1  evvsvrlvrdkltgrsrgfafVefeseedaekale.lnglllggrplrvela------------------
00467851   1/1  skfGevvsvrilrd...gkskgfafVeFedeedaekAlealngkeldgrplrvefakpkslrrgrgggrs
00476311   1/1  evvsvkvvrdk.tgkskgfafVeFeseedaekAiealngrelggrplkvela------------------
00522311   1/1  evvsvrivrdkntgrsrgfafVeFedpedaekAlealngkelggrplrvelakpk---------------
00522291   1/1  evvsvrivrdketgrsrgfafVeFeseedaekAlealngkelggrplrvelakpk---------------
00522361   1/1  evvsvrivrdketgkskgfafVeFeseedaekAle.lngkeldgrplrvelakpkserl-----------
00508031   1/1  evvsvrivrdkntgrskgfafVeFeseedaekAle.lngtelggrplrvelakpk---------------
00505151   1/1  evevsvrivrdk.tgkskgfafVeFeseedaekAle.lngkelggrplrvelakpkelrlallgl-----
00378341   1/1  evvsvrivrdketgrsrgfafVeFeseedaekalealngkllggrplrvelakp----------------
00416531   1/1  evksvriprdkdgltgkskgfafVeFespedaekAlealngrkldgrplrvelak---------------
00504661   1/1  evvsgvrivrdk.tgkskGfafVeFeseedaekAl.alngkelggrplrvelakpkelrrllgrgl.grg
00474221   1/1  evvsvrllrdketgrskgfafVefeseedaekale.lnglllggrplrvelA------------------
00494921   1/1  evvsvrilrdkntgrsrgfafVeFeseedaekAlealngkelggrplrvelakpk---------------
00494161   1/1  evlsvrilrdk....skgfafVeFedpedAekAlealngteldgrplrvefakskslrlsvgrggggsrg
00522431   1/1  evvsvrlvrdkntgrskgfafVeFeseedaekal..lngkelggrplrvklakpk---------------
00486821   1/1  evvsvrlvrdkntgrskgfafVeFeseedaekAlealngkeldgrplrvelakpk---------------
00508371   1/1  evvsvrilrdkntgksrgfafVeFeseedaekalealngkeldgrplrvelakpk---------------
00522401   1/1  lFskfGevvsvrivrdketgrskgfafVeFedeedaekAlealng.elggrplrvelakpkllrrlllg-
00486801   1/1  evvsvrivrdkntgrskgfafVeFedeedaekAlealngkelggrplrvelakpkelrrglggggggggg
00526221   1/1  skfGevksvrivrd...grsrgfafVeFedpedaekAlealngkelggrplrvelakpkeprlrlrgggg
00522381   1/1  evvsvrlvrdketgksrgfafVeFeseedaekalealngteldgrplrvelakpk---------------
00458931   1/1  evvsvrllrdketgrsrgfafVeFeseedaekalealngkllggrplrvelakpk---------------
00505771   1/1  .vvsvrivrdkletgrskgfafVeFeseedaekAle.lngkelggrplrvelakp---------------
00508061   1/1  evvsvrlvrdkltgkskgfafVefeseedaekalealngllldgrllrV---------------------
00522211   1/1  evvsvrlvrdknetgrsrgfafVeFeseedaekaleallngtelggrplrvelak---------------
00508341   1/1  evvsvrivrdk.tgrskgfafVeFespedaekAlealngkelggrplrvelakpk---------------
00462871   1/1  evvsvrllrdketgrsrgfafVeFeseedaekalealngkllggrplrvelakpk---------------
00497691   1/1  evvsvrivrdketgkskgfafVeFedeedaekAle.lngkeldgrrlrvelakpkksrsrgggglpgrtl
00471721   1/1  evvsvrlvrdkltgkskgfafVeFeseedaekale.lnglllggrllrvelA------------------
00533131   1/1  evvsvrlvrdketgkskgfafVefedeedaekalealnglelggrplrvelakpk---------------
00522451   1/1  evvsvrlvrd..tgkskgfafVeFedeedaekAlealngkeldgrplrvelakpk---------------
00468761   1/1  evvsvrllrdkltgrsrgfafVeFedeedaekalealngklldgrplrvelakpk---------------
00467941   1/1  evvsvriv.dketgrsrgfafVeFeseedaekAle.lngtelggrplrvelakpk---------------
00462861   1/1  evvsvrlvrdketgrsrgfafVeFedeedaekalealngkeldgrplrvelakpk---------------
00489841   1/1  fGevvsvrilrdk.....kgfafVeFedeedaekAlealngkelggrplrvelakpkelrrsrgrgrsrg
00524411   1/1  fgevvsvrlvllkdketgksrgfaFVeFeseedaekAlkalngteldgrplrvew---------------
00522181   1/1  skfgevvsvkillllllllildketgkskgfafVeFespedaekAiealngkelg---------------
00528991   1/1  geivsvrilrdklstgrskgfafVeFeseedaekAle.lngkllggrplrvelak---------------
00453731   1/1  evvsvrlvrdkltgrsrgfafVeFeseedaekale.lngkllggrllrvelA------------------
00522481   1/1  evvsvrllrdketgrskgfafVeFeseedaekAlealngkllggrplrvelA------------------
00454791   1/1  evvsvrllrd.....skgfafVeFedeedaekAlealngklllggrplkvef------------------
00505661   1/1  evvsvrivrdkntgrsrgfafVeFespedaekAlealngkeldgrplrvelakpkeerrrgggggg----
00508091   1/1  evvsvrivrdketgrskgfafVeFeseedaekalealngllllpgtlldgrplrv---------------
00522351   1/1  evvsvrivrd..tgkskgfafVeFeseedaekAiealngkeldgrplrvelakpk---------------
00462201   1/1  evvsvrivrdkltgrskgfafVeFedeedaekalealngkllggrplrvelakpk---------------
00522321   1/1  evvsvrlvrdkntgrskgfafVeFeseedaekalealngklldgrplrvelakpk---------------
00528971   1/1  evlsvrlvrdrltgrsrgfafVeFeseedaekaiealngkeldgrplrvelakpk---------------
00524421   1/1  evksvkvprd....kskgfafVeFkdpedAekAiealngrefggrpirvela------------------
00508021   1/1  relFskfGevvsvrivrd...gkskgfafVeFedpedaekAiealngtelggrpl---------------
00420611   1/1  evksvkiird......kgfafVeFedeaedaekAlealngtkldgrplrvewaklk...........ger
00522191   1/1  evvsvrivrklldketgkskgfafVeFespedaekAlealngklldgrklrvela---------------
00508081   1/1  evvsvrivrd......kgfafVeFeseedaekAlealngkeldgrplrvelakpk---------------
00522221   1/1  kfGevvsvrivrdkntsgsgrsrgfafVtfeseedaekAiealngtlldg--------------------
00505141   1/1  evvsvrivrd.......gfafVeFedeedaekAlealngkeldsllgslrplrvelakpkld--------
00484001   1/1  evvsvkilrdk.tgrsrgfafVefeseedaekAlealngkllggrplrvelakp----------------
00493341   1/1  evvsvrlvrdk.tgkskgfafVeFeseedaekAle.lngkelggrplrvklakpkeerkrggrggglgg-
00508381   1/1  evvsvrllrddketgkskgfafVeFedeedaekalealngkllggrplrvelakp---------------
00428601   1/1  evvsvrllrdk....skgfafVeFeseedaekAlealngkelgggrplrvelakp---------------
00505671   1/1  evvsvrivrdkn......fafVeFedeedaekAlealngkeldgrplrvelak.......rgrfgarprg
00504791   1/1  evvsvrivrd.....skgfafVeFedeedaekAl..lngkeldgrplrvelakpkeer------------
00504781   1/1  .vvsvrlvrdk.tgrskgfafVeFaseedaekAlk.lngtelggrpirvelaspkellrvlgsgg-----
00457471   1/1  skfGevvsvrvlrd...gksrgfafVeFedeedaekAlealngkeldgrplrvelakpkedrrs------
00361651   1/1  evvsvrilrd..tgkskgfafVeFeseedaekalealngkllggrplrvelakpk---------------
00522391   1/1  evvsvrilrdkntgrsrgfafVeFeseedaekalealngklldgrplrV---------------------
00497751   1/1  fgevvsvrilllllvldketgrskgfafVeFesvedaekAle.lngtelggrpl----------------
00522341   1/1  evesvkllrd......kgyafVeFeseedaekAiealngkelggrplrvewakpk---------------
00517481   1/1  evvsvrilrd......kgfafVeFedeedaekAlealngkelllggrplrvelakpkelrlklglgg..-
00467951   1/1  evvsvri.....tgkskgfafVeFeseedaekAlealngkeldgrplrvelakpk---------------
00522171   1/1  evvsvrilrd......kgfafVeFedeedaekAlealngklldgrplrvelakpk---------------
00520821   1/1  evvsvkilrd......rgfafVefedpedaekAiealngkelggrplrvelakpk---------------
00504801   1/1  Gevvsvriv........kgfafVeFedeedaekAiealngkelggrplrvelakp---------------
00522301   1/1  evlssvrilrdk.tgrskgfafVeFeseedaekAle.lngkelggrplrvelakpkelrealgggrrgll
00498881   1/1  LrelFskyGevvsvriv........kgyafVeFadeesaekAl.alngrelggrp---------------
00505681   1/1  evvsvkvvrd......kgfafVeFedeedaekAiealngkelggrplrvelakpk---------------
00528981   1/1  evlsvrilrd..tgkskgfafVeFeseedaekAle.lngtllggrllrvelak-----------------
00522231   1/1  evvsvrllrd......kgfafVeFedeedaekAlealngteldgrplrvelakpk---------------
00504811   1/1  Gevvsvrv........skgfafVeFedeedaekAiealngkeldgrplrvelakp---------------
00504761   1/1  evvsvkilrd......kgfAfVeFeseedaekAlealngtplllggrplrveyakpkelllsgngsgs--
00522441   1/1  evvsvrl......grsrgfafVefedeedaekAlealngkllldgrplrvelakp---------------
00504771   1/1  Fskygkivsvril......kskgfafVeFenpedAakAlealngtellgkelkv----------------
00522331   1/1  evvsvrllrd......kgfAfVeFedeedaekAlealngtplllggrplrve------------------
00505121   1/1  evl.......lltgkskgfafVefeneedaqkAiealngtelkgrplvVelakpkelrlsgpssg-----
00508071   1/1  Gkvvsvrllrd......kgfAfVefetredAeaAiealslngkelggrplrv------------------
00524291   1/1  kvlsvkilrdkn...skgfafVefesledalkAiealnglllggrplrvslaksk---------------
00508041   1/1  evvsvkvvrd.......gfafVeFeseedaekAieklngteldgrrlrvelarpkerrrsslgrggggg-
00505651   1/1  nvlsvkv........skgfAfVefespesAqaAiealnglellgrplkvkfakskeerlsgkssgdsl--
00505761   1/1  evlsv.......tgkskgfafVefeseedaekAlealngtllggrplrvelakpk---------------
00508051   1/1  Gkvlsvkvlrd......kgfAfVefeteedAeaalealnglglllggrplrvsls---------------
00507271   1/1  eilsvrllrd......kgfafvefeskesAekAl.elngkvlggrlllkvelakdkslq-----------
00445421   1/1  eldyfyyfpgdfstkpskysrayvnfkspedavefikaldgk----------------------------


                         -         -         -         +         -         -         -:280
query           KGGNTSGSGAGGGKASKAGGKAPDSGIQKKQAKTKGGLRVLG----------------------------
00471081   1/1  ldgrplrVelakpkee------------------------------------------------------
00471971   1/1  ----------------------------------------------------------------------
00498011   1/1  gg...-----------------------------------------------------------------
00508391   1/1  ----------------------------------------------------------------------
00498431   1/1  ----------------------------------------------------------------------
00467851   1/1  ggrgggrggggg----------------------------------------------------------
00476311   1/1  ----------------------------------------------------------------------
00522311   1/1  ----------------------------------------------------------------------
00522291   1/1  ----------------------------------------------------------------------
00522361   1/1  ----------------------------------------------------------------------
00508031   1/1  ----------------------------------------------------------------------
00505151   1/1  ----------------------------------------------------------------------
00378341   1/1  ----------------------------------------------------------------------
00416531   1/1  ----------------------------------------------------------------------
00504661   1/1  l---------------------------------------------------------------------
00474221   1/1  ----------------------------------------------------------------------
00494921   1/1  ----------------------------------------------------------------------
00494161   1/1  ltlgglgrgg------------------------------------------------------------
00522431   1/1  ----------------------------------------------------------------------
00486821   1/1  ----------------------------------------------------------------------
00508371   1/1  ----------------------------------------------------------------------
00522401   1/1  ----------------------------------------------------------------------
00486801   1/1  g---------------------------------------------------------------------
00526221   1/1  ggggggggggggggg-------------------------------------------------------
00522381   1/1  ----------------------------------------------------------------------
00458931   1/1  ----------------------------------------------------------------------
00505771   1/1  ----------------------------------------------------------------------
00508061   1/1  ----------------------------------------------------------------------
00522211   1/1  ----------------------------------------------------------------------
00508341   1/1  ----------------------------------------------------------------------
00462871   1/1  ----------------------------------------------------------------------
00497691   1/1  fvgnlppdvteedlrelfskfGevvsvriv----------------------------------------
00471721   1/1  ----------------------------------------------------------------------
00533131   1/1  ----------------------------------------------------------------------
00522451   1/1  ----------------------------------------------------------------------
00468761   1/1  ----------------------------------------------------------------------
00467941   1/1  ----------------------------------------------------------------------
00462861   1/1  ----------------------------------------------------------------------
00489841   1/1  lsrgrlrggllglglg------------------------------------------------------
00524411   1/1  ----------------------------------------------------------------------
00522181   1/1  ----------------------------------------------------------------------
00528991   1/1  ----------------------------------------------------------------------
00453731   1/1  ----------------------------------------------------------------------
00522481   1/1  ----------------------------------------------------------------------
00454791   1/1  ----------------------------------------------------------------------
00505661   1/1  ----------------------------------------------------------------------
00508091   1/1  ----------------------------------------------------------------------
00522351   1/1  ----------------------------------------------------------------------
00462201   1/1  ----------------------------------------------------------------------
00522321   1/1  ----------------------------------------------------------------------
00528971   1/1  ----------------------------------------------------------------------
00524421   1/1  ----------------------------------------------------------------------
00508021   1/1  ----------------------------------------------------------------------
00420611   1/1  ekellgkilggrgsrlgrrrggg-----------------------------------------------
00522191   1/1  ----------------------------------------------------------------------
00508081   1/1  ----------------------------------------------------------------------
00522221   1/1  ----------------------------------------------------------------------
00505141   1/1  ----------------------------------------------------------------------
00484001   1/1  ----------------------------------------------------------------------
00493341   1/1  ----------------------------------------------------------------------
00508381   1/1  ----------------------------------------------------------------------
00428601   1/1  ----------------------------------------------------------------------
00505671   1/1  rgsgrgllllllgllllll---------------------------------------------------
00504791   1/1  ----------------------------------------------------------------------
00504781   1/1  ----------------------------------------------------------------------
00457471   1/1  ----------------------------------------------------------------------
00361651   1/1  ----------------------------------------------------------------------
00522391   1/1  ----------------------------------------------------------------------
00497751   1/1  ----------------------------------------------------------------------
00522341   1/1  ----------------------------------------------------------------------
00517481   1/1  ----------------------------------------------------------------------
00467951   1/1  ----------------------------------------------------------------------
00522171   1/1  ----------------------------------------------------------------------
00520821   1/1  ----------------------------------------------------------------------
00504801   1/1  ----------------------------------------------------------------------
00522301   1/1  g---------------------------------------------------------------------
00498881   1/1  ----------------------------------------------------------------------
00505681   1/1  ----------------------------------------------------------------------
00528981   1/1  ----------------------------------------------------------------------
00522231   1/1  ----------------------------------------------------------------------
00504811   1/1  ----------------------------------------------------------------------
00504761   1/1  ----------------------------------------------------------------------
00522441   1/1  ----------------------------------------------------------------------
00504771   1/1  ----------------------------------------------------------------------
00522331   1/1  ----------------------------------------------------------------------
00505121   1/1  ----------------------------------------------------------------------
00508071   1/1  ----------------------------------------------------------------------
00524291   1/1  ----------------------------------------------------------------------
00508041   1/1  ----------------------------------------------------------------------
00505651   1/1  ----------------------------------------------------------------------
00505761   1/1  ----------------------------------------------------------------------
00508051   1/1  ----------------------------------------------------------------------
00507271   1/1  ----------------------------------------------------------------------
00445421   1/1  ----------------------------------------------------------------------