[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_01234


[Show Plain Result]

## Summary of Sequence Search
   1::388
 111::375    6e-42 40.1% 0052657 00526571 1/1   minate synthase-like                    
  95::375  4.2e-17 25.4% 0053127 00531271 1/1   minate synthase-like                    
   1::388


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGPTSFPFNQVPERLRMVPAEKLSPYERAPAAVRELYSECRRLSALQIDSHPQILDFQGLNKDRLPDGIV
00526571   1/1  ----------------------------------------------------------------------
00531271   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LKECIPPSSLELAFDEFMGSNSWRKDLRDGRDGACVYGIRQVPGLRILPSLLPPAVQTELLSRLLHRDLS
00526571   1/1  ----------------------------------------lppglvllpgflspeeqalllelllelpws
00531271   1/1  ------------------------lvldellllptplllllvpgltlipdflspeeadalleell....d


                         +         -         -         -         -         *         -:210
query           DERHQTNLHLHYDVSYPSPSSDANGASALKGTQQEACWSTNSSFFRDDPTRTFSPKDATVHRPLSIQAAL
00526571   1/1  plrinlf...................................................gkgvllsrltal
00531271   1/1  elpwrrdtitlfgkvvlspr..................................................


                         -         -         -         +         -         -         -:280
query           NSKLRWITLGGQYNWTTKEYPPGPPPAFPSDISTLLHSIFPETTAEAAIVNLYSPGDTLNPHRDVSEECD
00526571   1/1  lgklrwvtlgygyrysgllyvsglplppipdlllallerlaalaglpdfvpnaclvnyYrpgdglglHqD
00531271   1/1  ..ltavyg.dagyrysgltllplrpwpplllalrdlleeltg.lpfnaclvnlYrdgsdsigwHsDdepe


                         -         *         -         -         -         -         +:350
query           TGLISISLGCHALFLVGHGNGDSCAVIRLRSGDAVYMTGASRFAWHAVPKIIPSTCPDWLKTWPGGGDVP
00526571   1/1  deeldfgppiaslSLgasavflfggktrggktlsllLesgdllvmggesrlawHgvpkikkdtlp.....
00531271   1/1  lgpgppiaslSLgatrvfllrhklrgdeggdssavetvslpLphgsllvmggetqltwlHgvpklkkv..


                         -         -         -         -         *         -         -:420
query           DEDSQRWWGWMAGKRVNLNVRQMFQSPPTNPAALGEND--------------------------------
00526571   1/1  .................llrggRin---------------------------------------------
00531271   1/1  .........................---------------------------------------------