[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_01277


[Show Plain Result]

## Summary of Sequence Search
   1::266
  21::247    1e-28 30.6% 0052782 00527821 1/1   inding split barrel                     
   5::211  3.1e-24 25.9% 0050360 00503601 1/1   inding split barrel                     
  18::194  9.9e-21 28.4% 0052681 00526811 1/1   inding split barrel                     
  22::193  4.4e-10 21.9% 0053043 00530431 1/1   inding split barrel                     
  19::190  8.5e-07 22.4% 0053034 00530341 1/1   inding split barrel                     
   1::266


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGKSLVYPKRESNTMNRYKHRGTYDLGPIHSIINSAPVLHVSFSPSPDDPFPAILPMIGQMGSFEYPSSG
00527821   1/1  --------------------raeldpeeilelldeapvgtLatv...ddggPyvspvpfvy.........
00503601   1/1  ----llyarslltllllsllkkslrlllllpltdrtrmyrpkdre.lddeeilelldearvgtLatvdgd
00526811   1/1  -----------------rrkraildreeileiLdearvgrLatvda..dgyPyvvPvlfvy.........
00530431   1/1  ---------------------eellpeeilallaearlgtLatv...ddGrPyvrpvlfvl.........
00530341   1/1  ------------------rkleeldkeeilelLasarvgrLAtvr...dgqPyvvPvnfvy.........


                         -         -         *         -         -         -         -:140
query           IDDPLECYLHGYVSSRIMNLARATDGKGLPICIAATHVDGLILTLTPNSHSYNYRSAVLHGYATLVTDVE
00527821   1/1  ..dggtlyfhtargsrkarnlra....nprVsllvdgpdgyvspswyfsptwnyrsvvvrGtaevvedpe
00503601   1/1  edGrelPyvvpvpfvydp........dgg.tlyfhtargsrkarnlra....nprVsllvdgpdgyvsps
00526811   1/1  dgd..tlyfhtakegrklenlrrnp....rVclevdgldglvlgrseeacnfstnyrsvivfGtaeived
00530431   1/1  ..ddgtlyfhtargsrkarnlranp....rVsllfdgpdgyvspswyasptlnyrsvrveGtaeivedee
00530341   1/1  ..dggtlyfhta.egrklenlranp....rVslevdd..........dddglgyrsvvveGraeivedge


                         +         -         -         -         -         *         -:210
query           EKLWAMKLITNSVVPQRWENTRIPPDGAEMQSTTILKVKIVDGSGKIRDGGVSDERKDKDRPDVTEKVWT
00527821   1/1  ekeealellleryepgrldpwr.dylekllkgivvlrieieevsgkfklgqnkdeadr........gvwa
00503601   1/1  wyfsptwnyrsvvvrGtaeivede.ekrealaallekyepgwwvddapdpyiekmlkaivvlrieieevs
00526811   1/1  leekeealelllekytpgl.....rdypdkelkgtvvlrieieeisgkarllgp----------------
00530431   1/1  elaellsrllakyepgqsdpirvldaledyiakllgrivgleieieevsgkf.-----------------
00530341   1/1  ekrealeallekylpglldllgesldlfafplaalpktvviritpeevtg--------------------


                         -         -         -         +         -         -         -:280
query           GVVPVWQTFGEPVPDGLNKVNEVPEHISSYIERMNEQNRKCAFDAIKVPLPKEEQH--------------
00527821   1/1  gllpltlelgep.......vaevpdyvldlleelnel---------------------------------
00503601   1/1  g---------------------------------------------------------------------
00526811   1/1  ----------------------------------------------------------------------
00530431   1/1  ----------------------------------------------------------------------
00530341   1/1  ----------------------------------------------------------------------