[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_01629


[Show Plain Result]

## Summary of Sequence Search
   1::694
 211::637  9.2e-65 32.4% 0051473 00514731 1/1   epeat                                   
 317::637  3.9e-51 30.8% 0052018 00520181 1/1   epeat                                   
   1::694


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MESEAKDPSAENGSKQKKPKKTKSTTSLSGIFKRSQRGKKGNSCEKEDKENVTMARGSNDMPPPPIPRSR
00514731   1/1  ----------------------------------------------------------------------
00520181   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AQSIQSQISSRYVSSGRTVEEEMSLYTPRGYSPSSQRNFYDFQQPSLTKRPDSKWRPKSEYGSSSTSSVK
00514731   1/1  ----------------------------------------------------------------------
00520181   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DILQSIHRRSPSAGSVKSNASRTHPLAERPPSEKRKSSNGNRGSRVMAAIAAFSAKDKNFDKPKPVDPKE
00514731   1/1  ----------------------------------------------------------------------
00520181   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           IDSEFERLLDARNIPHNMRDRMRSLNTNIKADFINKNQIEGECSSASASAQRQFVTTSHKRTKSKDSSFG
00514731   1/1  ieelFeelldelnlpeekrelllnlplekKwelilqdl................................
00520181   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RSENRGTKKRPKSADLSIPSRLPSGGLNPALPSPDLIADPTDFVHYLKEVQKPEIVEVSKLHKLRILLRN
00514731   1/1  ........................lsslegqelasvtasPelyiklLrsvlkke.vslkvlksLrvsLrt
00520181   1/1  ------------------------------------lgsPelyikkLrslldkell.lkllksLrvsLrt


                         -         -         -         -         *         -         -:420
query           ETISWVESFISHGGMEQLVDLLYRILKVEWREEHEDVLLHEVLLCIKALCTTSPALHQLCKIGDDLFPTL
00514731   1/1  epvsWveeF.elgGldaLlelLskllenavldreehdldllheclrcLkalmntklGlelvls.hpelin
00520181   1/1  epvsWveeF.elgGldaLlelLsklllkeisdleeadldllheilrcLkalmntklGlelvls.hpelvn


                         -         -         +         -         -         -         -:490
query           LRMLFGEEKKGPSEFATRNIIISLLFSHLSSATFEEVATRARTILSYMHDPKPPKESAPLPFIAEMHQAR
00514731   1/1  llalsLl......ssnlrtrklvlellaalclvseeegghekvlealdnlkvlgek..............
00520181   1/1  llalsLl......sknlrtrklvlelLaalclvsepsgghelvlealde.....................


                         *         -         -         -         -         +         -:560
query           PYQLWCKEMSNVTKEVFWIFLHHFNVVPVAKAEDSSLPFIQRYFPPPHTPVPAAPYIGGVEWDATNYLAT
00514731   1/1  ....rrFqllvkllk..................................................esdni
00520181   1/1  ......lke.lge.....kkrFeilvslle...................................esdni


                         -         -         -         *         -         -         -:630
query           HLDLINGLLASLPTIEERNELRTHLRASGLEKVMGRSLRTCKEKLYPAVHEALKVWVSAAADDEWDYQFV
00514731   1/1  eylvatlllinallssvedlefRvhlRnellllgllkil....eklreleyddLdvqlevfeenaeedee
00520181   1/1  eylvatlllinallssvedlefRvhlrnellrlgLlkile....klreleyedLdvqldifeenaeedee


                         -         +         -         -         -         -         *:700
query           REGPPRDAPPSTPRSPIKGCGSPKKLGIVGDAPPKIDFHVGISGNSNARNEQNRSQGLVNDGWI------
00514731   1/1  elkdrfd---------------------------------------------------------------
00520181   1/1  ellerfe---------------------------------------------------------------