[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_01668


[Show Plain Result]

## Summary of Sequence Search
   1::628
  17::466   7e-145 43.7% 0052638 00526381 1/1   airpin glycosidases                     
  33::503 5.1e-136 33.8% 0046953 00469531 1/1   airpin glycosidases                     
  31::478  1.5e-69 30.9% 0049896 00498961 1/1   airpin glycosidases                     
  32::477  1.7e-51 26.9% 0047967 00479671 1/1   airpin glycosidases                     
 512::605  4.2e-28 45.7% 0047883 00478831 1/1   h-binding domain-like                   
 511::617    2e-27 38.3% 0042793 00427931 1/1   h-binding domain-like                   
 514::614    2e-27 41.0% 0042222 00422221 1/1   h-binding domain-like                   
 513::617  4.3e-27 41.0% 0036196 00361961 1/1   h-binding domain-like                   
 513::617  4.1e-26 40.4% 0036004 00360041 1/1   h-binding domain-like                   
 515::617  1.4e-25 39.2% 0036255 00362551 1/1   h-binding domain-like                   
 516::615  3.5e-24 41.2% 0036120 00361201 1/1   h-binding domain-like                   
 513::616  5.3e-24 41.7% 0035978 00359781 1/1   h-binding domain-like                   
   1::628


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MMLSILRALYAVPLVYSLVSGSEAKFALRQEETLEQWLETESSYALQSILDNIGDDGAKVQGAHAGIVVA
00526381   1/1  ----------------lvlssgleslleltlnyweswlskltgialdlylrslltlkllvdgaptGaviA
00469531   1/1  --------------------------------AywrswlsketllallgllrnlvlrsllvlkaptGaii
00498961   1/1  ------------------------------PlssldgrlrdlvrrslltlklltnieptGaivaaaslPe
00479671   1/1  -------------------------------ssldgllrdlvlrslltlklltgs.......pvtGaiiA
00478831   1/1  ----------------------------------------------------------------------
00427931   1/1  ----------------------------------------------------------------------
00422221   1/1  ----------------------------------------------------------------------
00361961   1/1  ----------------------------------------------------------------------
00360041   1/1  ----------------------------------------------------------------------
00362551   1/1  ----------------------------------------------------------------------
00361201   1/1  ----------------------------------------------------------------------
00359781   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SPSRADPDYFYTWTRDAALVFKHLIDAFVAGNHDSQDRIHEYITAQSYLQTVSNPSGTLSTGGLGEPKFH
00526381   1/1  spstsnpdYrYvWlRDaaltalaLlaagytdeadkfleflidlyisdgaflqrvynpsgsldlgwlsglg
00469531   1/1  AspstslPdYryvWvRDaaltalallalgldearsaleflldllsaqaqlqivynpdgslplnelllpgy
00498961   1/1  gviasggtrnpdYryvWgRDsaitalall...aaGdpel...argalewlarlqaldd........Glip
00479671   1/1  apttslpeivpgagnpdyryvWlRDsaiaalallll...gdpelargillwlarlqae............
00478831   1/1  ----------------------------------------------------------------------
00427931   1/1  ----------------------------------------------------------------------
00422221   1/1  ----------------------------------------------------------------------
00361961   1/1  ----------------------------------------------------------------------
00360041   1/1  ----------------------------------------------------------------------
00362551   1/1  ----------------------------------------------------------------------
00361201   1/1  ----------------------------------------------------------------------
00359781   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VDQSAFTGSWGRPQADGPALRATAMITYAKWLIANGHEDAAKSIVWPVVQNDLSYVGQFWNSTGFDLWEE
00526381   1/1  epkfnvdgteftgdwgrpQrDgpalrilalaaylqllldiggelldalylanklglalldlywpiikkdl
00469531   1/1  rvdgpvrvgnwgqlQlDatglvllalaqylralidtgllefldellwplirnlldylarawrepdfgiWE
00498961   1/1  hrfrvdGnaa...wgylqlDatalfllalyqyyk.tgd........delwpalkraldyilrywdrpgfg
00479671   1/1  .dGliphkfvvdgnaa...ygrlqlDapplfllalyeyykatg...........dlaflkellpylekal
00478831   1/1  ----------------------------------------------------------------------
00427931   1/1  ----------------------------------------------------------------------
00422221   1/1  ----------------------------------------------------------------------
00361961   1/1  ----------------------------------------------------------------------
00360041   1/1  ----------------------------------------------------------------------
00362551   1/1  ----------------------------------------------------------------------
00361201   1/1  ----------------------------------------------------------------------
00359781   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VQGSSFFTAIAQHRALAEGNNLARQLGTDCPHCESQAPQILCFLQSFWTGSNIIANFGGDRSGLDANSLL
00526381   1/1  dylvkywpepdfdlWEerggyhffTlavqyaALvaaaklakalgdpalaerwlsaadeikeqileflqsf
00469531   1/1  erpghhtstiamawaALdraarlaellgdladrwlaladeirdilerfwnpergafvlpygssglDasll
00498961   1/1  lWedrpgasvetnallyaalrraaelaellgdpelaerwraladelkaaieehfwdeelglfvdgyyara
00479671   1/1  plpgfglWedrpgasvetnallyaalraaaelaellgdpelaeryraladelkaaieehfwdeegllgvg
00478831   1/1  ----------------------------------------------------------------------
00427931   1/1  ----------------------------------------------------------------------
00422221   1/1  ----------------------------------------------------------------------
00361961   1/1  ----------------------------------------------------------------------
00360041   1/1  ----------------------------------------------------------------------
00362551   1/1  ----------------------------------------------------------------------
00361201   1/1  ----------------------------------------------------------------------
00359781   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GIIHNFDPEADCDDNTFQPCSSRALANHKKVTDSFREIYPINSGMEGDQAVAVGRYAEDVYYGGQPWYLA
00526381   1/1  wngelgyfvrslllvlgggrsglDasllllslhtfdp.alvdfgllppddprilntlkaiedslrvlypi
00469531   1/1  llslvgflaragvddltfapddprllatlkaiedelrvdypinsglslglGlavgRYpeDgygggnpWll
00498961   1/1  ldgdgrsaidalsllgsilvvdgdagldaslllllllgalspddpralatleaiesplltglg..lgtlv
00479671   1/1  gyfvdaydsdgrplgilkdllgsilllddanvldaslllalllgllpadderalatldaiedelllytpy
00478831   1/1  ----------------------------------------------------------------------
00427931   1/1  ----------------------------------------------------------------------
00422221   1/1  ----------------------------------------------------------------------
00361961   1/1  ----------------------------------------------------------------------
00360041   1/1  ----------------------------------------------------------------------
00362551   1/1  ----------------------------------------------------------------------
00361201   1/1  ----------------------------------------------------------------------
00359781   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           TFASAELLYDAIYQWNHTGKITITDVSLPFFQSIYKSAQVGTYSSSTNVFSEIIANVGSYADGYLNVARK
00526381   1/1  nsglsl..gggvgRYpeDvydgggtgegnpWfltTlwlaeylyragydlldkqgsltvtsvslaffkdlv
00469531   1/1  ctlwlaealyaaageldeaeelfeellslglfseeidpvtgellgnfpqafshlinalvtladgllkpvl
00498961   1/1  grYpedgyggyhnggvwphcg...aetlWplgalalalarlgrldealellerllalan.glgllpEqvf
00479671   1/1  G...lrtlrygddgyrggydpgydwgyhnGgvWplltgwlaeallrlgreare.................
00478831   1/1  ----------------------------------------------------------------------
00427931   1/1  ----------------------------------------------------------------------
00422221   1/1  ----------------------------------------------------------------------
00361961   1/1  ----------------------------------------------------------------------
00360041   1/1  ----------------------------------------------------------------------
00362551   1/1  ----------------------------------------------------------------------
00361201   1/1  ----------------------------------------------------------------------
00359781   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           YTPCSGALAEQFSRNDGTPLSASDLTWSYAALLTAKERRESVVPGSWGQKSAHDVPPTCLATSAAGSYQT
00526381   1/1  ssaslldlslldldlgtysssssefnelidalldkAdsllewvlky------------------------
00469531   1/1  yhapsdgllpEqvnpetgvplsatpLtWshAlyllalllregllppswldpvarrlpsvlsalsvlglyl
00498961   1/1  ........................dgvlaerfdpdtgeplgsafpqaWshaalllall------------
00479671   1/1  .............................llerllklanglgllpEqydgdtgeplg-------------
00478831   1/1  ----------------------------------------------------------------------
00427931   1/1  ----------------------------------------------------------------------
00422221   1/1  ----------------------------------------------------------------------
00361961   1/1  ----------------------------------------------------------------------
00360041   1/1  ----------------------------------------------------------------------
00362551   1/1  ----------------------------------------------------------------------
00361201   1/1  ----------------------------------------------------------------------
00359781   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           ATITGWPSTLTPTPTPTNPAPCPTPSSVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYE
00526381   1/1  ----------------------------------------------------------------------
00469531   1/1  latlvslpelllt---------------------------------------------------------
00498961   1/1  ----------------------------------------------------------------------
00479671   1/1  ----------------------------------------------------------------------
00478831   1/1  ---------------------vltsglvkvtFrvnaptafgesvyvvGsipeLGnWdpskavplsasgyt
00427931   1/1  --------------------lsggqvlvtvtfnvlattalgesvyvvGsvpeLGnWdpskalplspsslp
00422221   1/1  -----------------------tggqvlvtFlvlnattalgesvyvvGsvpeLGnWdpkkalplsasdl
00361961   1/1  ----------------------ltggqvlvtFlvllattalgesvyvvGsvpeLGnWdpskalplsasey
00360041   1/1  ----------------------ltggqvlvtFrvlvattalgesvyvvGsvpeLGnWdpskavplsasdl
00362551   1/1  ------------------------ggqvlvtFlvllattalgesvyvvGsvpeLGnWdpskalplsasdl
00361201   1/1  -------------------------gqvlvrFlvllattalgesvyvvGsvpeLGnWdpskavplla..s
00359781   1/1  ----------------------ltsglvlvtFnvlvattalgeslyvvGsvpeLGnWdpskavplsasel


                         -         -         -         *         -         -         -:630
query           ASCPLWSIQIDLAAGKKFDYRYIRKSDDGRVVWESDPNRSYTVPKNLEYQRRPSSSPAIQQRAKLPPH--
00526381   1/1  ----------------------------------------------------------------------
00469531   1/1  ----------------------------------------------------------------------
00498961   1/1  ----------------------------------------------------------------------
00479671   1/1  ----------------------------------------------------------------------
00478831   1/1  ledplWtatvelpagttieYKyvivdedgvviwesgpnrvltvps-------------------------
00427931   1/1  lltlsyplWsatvslpagttieYKylkkdedgnvrwesgpnrlltvpssgtlvvvdg-------------
00422221   1/1  tssyplWsaevslpagttieYkylkvd.dgnviwesgpnrrltvpssgtltvsd----------------
00361961   1/1  tssyplWsaevslpagttieYkylkvdsdgnviwesgpnrlltvplsgtlivtvgwl-------------
00360041   1/1  tssyplWsaevslpagttieYkylkvd.dgnviwesgpnrrltvpvsgtltvsdgwl-------------
00362551   1/1  tssyplWtaevslpagttieYkylkvd.dgnviwesgpnrlltvpvsgtltvsdgwl-------------
00361201   1/1  tssdplWtaevslpagttieYkylkkdedgevliwesgpnrlltvp.sgtllvvd---------------
00359781   1/1  ltssyplWtgevslpagttieYkyikkd.dgsvrwesgpnrlltvpssgtltvddg--------------