[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_01675


[Show Plain Result]

## Summary of Sequence Search
   1::270
  19::155  1.5e-27 40.2% 0052133 00521331 1/1   main-like                               
  27::163  1.2e-20 30.9% 0053042 00530421 1/1   main-like                               
   1::270


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGRPTCPQKPPKRSILSRLHPNSWVMLHETDGFVRLPNERLIYTSPLRTTISLQALNPRPGDESLSLQSS
00521331   1/1  ------------------lmalnwvdlttsggpvllpgEvlll...vqdgVgL.....yegklk.ilgfq
00530421   1/1  --------------------------llesggplllenEslll........vqdgvglydgdlki..nlq


                         -         -         *         -         -         -         -:140
query           NGRVHLTNQRIVYLPVQPTPQFQSFSAPLLNLHDTFVSAPFFGPNVWSAIVQPVVGGGIPPSNTAVQVKM
00521331   1/1  nGrlyLTshRiiyvdsde.psflslalplslvvsvevsapffgsspkiilllkpvpggglpgpassssav
00530421   1/1  nGrlyLTthRiiyvdkgdpklslslplslilsve.ivagflfsspkiilllkpesgggipgildssiavy


                         +         -         -         -         -         *         -:210
query           TFKEGGAFDFHSAFERIKERLQQVVEQARENGMISERSSQRDGAYSGVNFTNVHLDELPAYEGPSPTSSS
00521331   1/1  vlklwfkeggafefv-------------------------------------------------------
00530421   1/1  ikLsFrkggeieF...yeaLlev-----------------------------------------------


                         -         -         -         +         -         -         -:280
query           FPPPFSGCSNPGNDLHSSQNTRHTPHEERFDPPTEPPPGYEEAQQQGVANDLEARLRRAQ----------
00521331   1/1  ----------------------------------------------------------------------
00530421   1/1  ----------------------------------------------------------------------