[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_01687


[Show Plain Result]

## Summary of Sequence Search
   1::385
 242::379  8.7e-12 32.7% 0037363 00373631 1/1   edoxin-like                             
   1::385


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASIFRRGLEYLSPSASPAPSSVSDYEATSVPATGKPAVASKVITAQSPSTLFTVVDPTVDGEDCDHDCA
00373631   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SCTIKYPAKFSVDYEDELYGHVKGWATHVLVATGKTDWVRDVADEKGSVMEAIERGGVSAKNGALKLSAS
00373631   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NIPVPDEYYHHPEGEQPTTVLLLPAFTIIDHVTPALVPNLIRQFVDLSPTTTTPLSDVMQIAGQEEPTEQ
00373631   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TPSDINIPERPPLDLKDLSESLPTSLRSRPCSHAAVILLCSQKTRDARCGQSAPLLRREFERHLRPLGLY
00373631   1/1  -------------------------------vgkhhilvCtggrrdgrcgtaCllrgaeellealkkelg


                         -         *         -         -         -         -         +:350
query           RDLHDERPGGVGIYFISHVGGHKYSANVIVYRRRNFEWFKEGKDDCSNNVESMEKEGASQGIWLARVRPE
00373631   1/1  iegla.......dglvtlvevgClgaCalgPvvvvy...........................pdgvwYg


                         -         -         -         -         *         -         -:420
query           DCEGIVKFTVLQGKVVKPGLQLRGGFDREKGLISW-----------------------------------
00373631   1/1  rvtpedveeildelllggepveelllgri-----------------------------------------