[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_02126


[Show Plain Result]

## Summary of Sequence Search
   1::598
 182::397  2.5e-19 25.5% 0044763 00447631 1/1   photyrosine protein) phosphatases II    
 265::394  9.6e-19 23.4% 0049772 00497721 1/1   photyrosine protein) phosphatases II    
 201::398  1.3e-17 24.5% 0048076 00480761 1/1   photyrosine protein) phosphatases II    
 201::394  3.9e-17 27.5% 0048179 00481791 1/1   photyrosine protein) phosphatases II    
 285::398  3.8e-15 27.2% 0046846 00468461 1/1   photyrosine protein) phosphatases II    
 303::403  9.7e-14 23.8% 0039614 00396141 1/1   photyrosine protein) phosphatases II    
 281::394  9.9e-13 28.6% 0043147 00431471 1/1   photyrosine protein) phosphatases II    
 281::399  1.4e-12 24.4% 0036282 00362821 1/1   photyrosine protein) phosphatases II    
 302::404  1.8e-12 26.0% 0041856 00418561 1/1   photyrosine protein) phosphatases II    
 285::397  3.2e-12 26.1% 0049260 00492601 1/1   photyrosine protein) phosphatases II    
 286::396  8.7e-11 23.4% 0037934 00379341 1/1   photyrosine protein) phosphatases II    
 303::401  1.1e-10 21.2% 0045098 00450981 1/1   photyrosine protein) phosphatases II    
 303::390  1.9e-10 21.6% 0045450 00454501 1/1   photyrosine protein) phosphatases II    
 303::390    2e-10 19.3% 0042113 00421131 1/1   photyrosine protein) phosphatases II    
 303::398  2.9e-09 20.8% 0040439 00404391 1/1   photyrosine protein) phosphatases II    
 303::390  1.2e-08 21.6% 0043336 00433361 1/1   photyrosine protein) phosphatases II    
 303::390  1.7e-07 22.7% 0040438 00404381 1/1   photyrosine protein) phosphatases II    
 303::390  9.4e-07 21.6% 0036941 00369411 1/1   photyrosine protein) phosphatases II    
 302::392    1e-06 23.0% 0051082 00510821 1/1   photyrosine protein) phosphatases II    
 302::412  7.5e-06 20.9% 0038934 00389341 1/1   photyrosine protein) phosphatases II    
 303::387  2.3e-05 17.6% 0047943 00479431 1/1   photyrosine protein) phosphatases II    
 277::417  7.9e-05 16.2% 0051429 00514291 1/1   photyrosine protein) phosphatases II    
 303::387  0.00014 16.5% 0051299 00512991 1/1   photyrosine protein) phosphatases II    
 303::377  0.00036 20.0% 0046845 00468451 1/1   photyrosine protein) phosphatases II    
 303::377  0.00086 21.6% 0050432 00504321 1/1   photyrosine protein) phosphatases II    
   1::598


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPLPSLKSSHQDQGSVNQSFLRPMSPNANPGPTESSNRRAKNLKNLSLRLPASPFRPPLSTAPIAESGRH
00447631   1/1  ----------------------------------------------------------------------
00497721   1/1  ----------------------------------------------------------------------
00480761   1/1  ----------------------------------------------------------------------
00481791   1/1  ----------------------------------------------------------------------
00468461   1/1  ----------------------------------------------------------------------
00396141   1/1  ----------------------------------------------------------------------
00431471   1/1  ----------------------------------------------------------------------
00362821   1/1  ----------------------------------------------------------------------
00418561   1/1  ----------------------------------------------------------------------
00492601   1/1  ----------------------------------------------------------------------
00379341   1/1  ----------------------------------------------------------------------
00450981   1/1  ----------------------------------------------------------------------
00454501   1/1  ----------------------------------------------------------------------
00421131   1/1  ----------------------------------------------------------------------
00404391   1/1  ----------------------------------------------------------------------
00433361   1/1  ----------------------------------------------------------------------
00404381   1/1  ----------------------------------------------------------------------
00369411   1/1  ----------------------------------------------------------------------
00510821   1/1  ----------------------------------------------------------------------
00389341   1/1  ----------------------------------------------------------------------
00479431   1/1  ----------------------------------------------------------------------
00514291   1/1  ----------------------------------------------------------------------
00512991   1/1  ----------------------------------------------------------------------
00468451   1/1  ----------------------------------------------------------------------
00504321   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LSEPSSPVRPHSRGSKRRPPNLTIQTPGFQRPYSSNGTRVVPPTPSVRPTLRHIESSPSLNSILSPTHTN
00447631   1/1  ----------------------------------------------------------------------
00497721   1/1  ----------------------------------------------------------------------
00480761   1/1  ----------------------------------------------------------------------
00481791   1/1  ----------------------------------------------------------------------
00468461   1/1  ----------------------------------------------------------------------
00396141   1/1  ----------------------------------------------------------------------
00431471   1/1  ----------------------------------------------------------------------
00362821   1/1  ----------------------------------------------------------------------
00418561   1/1  ----------------------------------------------------------------------
00492601   1/1  ----------------------------------------------------------------------
00379341   1/1  ----------------------------------------------------------------------
00450981   1/1  ----------------------------------------------------------------------
00454501   1/1  ----------------------------------------------------------------------
00421131   1/1  ----------------------------------------------------------------------
00404391   1/1  ----------------------------------------------------------------------
00433361   1/1  ----------------------------------------------------------------------
00404381   1/1  ----------------------------------------------------------------------
00369411   1/1  ----------------------------------------------------------------------
00510821   1/1  ----------------------------------------------------------------------
00389341   1/1  ----------------------------------------------------------------------
00479431   1/1  ----------------------------------------------------------------------
00514291   1/1  ----------------------------------------------------------------------
00512991   1/1  ----------------------------------------------------------------------
00468451   1/1  ----------------------------------------------------------------------
00504321   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           PMMPAPFPSKPFSLGTWCDADLGKASNQTNFNPNEPLIEFGEEDDCPISRESRKGSERGYPDGPIRIYDS
00447631   1/1  -----------------------------------------pldrtrvllsnleglersdyinaseilpg
00497721   1/1  ----------------------------------------------------------------------
00480761   1/1  ------------------------------------------------------------pywpseilpg
00481791   1/1  ------------------------------------------------------------psnpseilpg
00468461   1/1  ----------------------------------------------------------------------
00396141   1/1  ----------------------------------------------------------------------
00431471   1/1  ----------------------------------------------------------------------
00362821   1/1  ----------------------------------------------------------------------
00418561   1/1  ----------------------------------------------------------------------
00492601   1/1  ----------------------------------------------------------------------
00379341   1/1  ----------------------------------------------------------------------
00450981   1/1  ----------------------------------------------------------------------
00454501   1/1  ----------------------------------------------------------------------
00421131   1/1  ----------------------------------------------------------------------
00404391   1/1  ----------------------------------------------------------------------
00433361   1/1  ----------------------------------------------------------------------
00404381   1/1  ----------------------------------------------------------------------
00369411   1/1  ----------------------------------------------------------------------
00510821   1/1  ----------------------------------------------------------------------
00389341   1/1  ----------------------------------------------------------------------
00479431   1/1  ----------------------------------------------------------------------
00514291   1/1  ----------------------------------------------------------------------
00512991   1/1  ----------------------------------------------------------------------
00468451   1/1  ----------------------------------------------------------------------
00504321   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GLWLYLEPNEEEASKFDVVFNVAKEVNNPFSTDGPKHDTVMSVWKATLAQSNAALRGEDPDTACSELSFK
00447631   1/1  .lylgslppaddlellkelgithivnlteelelgflkcdpywpeeag.......................
00497721   1/1  ------------------------------------------------------kvayplasfsellihd
00480761   1/1  lylgslptaldlellkdlgittvlnl............................................
00481791   1/1  lylgslptaldlellkklgittvinlteeyepeflere................................
00468461   1/1  ----------------------------------------------------------------------
00396141   1/1  ----------------------------------------------------------------------
00431471   1/1  ----------------------------------------------------------------------
00362821   1/1  ----------------------------------------------------------------------
00418561   1/1  ----------------------------------------------------------------------
00492601   1/1  ----------------------------------------------------------------------
00379341   1/1  ----------------------------------------------------------------------
00450981   1/1  ----------------------------------------------------------------------
00454501   1/1  ----------------------------------------------------------------------
00421131   1/1  ----------------------------------------------------------------------
00404391   1/1  ----------------------------------------------------------------------
00433361   1/1  ----------------------------------------------------------------------
00404381   1/1  ----------------------------------------------------------------------
00369411   1/1  ----------------------------------------------------------------------
00510821   1/1  ----------------------------------------------------------------------
00389341   1/1  ----------------------------------------------------------------------
00479431   1/1  ----------------------------------------------------------------------
00514291   1/1  ------------------------------------------------------------------vdLr
00512991   1/1  ----------------------------------------------------------------------
00468451   1/1  ----------------------------------------------------------------------
00504321   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SALESLSDECPPTPKANRPEPEYIHVPWDHNSEILDDLFPLCEIIDNRISKGKRVLIHCQLGVSRSASLV
00447631   1/1  .........................iqylhipipDhgvpdllehflefvefieealdekggpvlVHCsaG
00497721   1/1  dllklllvlnrrslsvlpeltilvadlflnrdknryldilpadnrvilpglpvsgsdyinasyvdgflkf
00480761   1/1  .............tselellerlgiqylylpwpDhgvpdllellleflefieealkeggpvlVHCsaGvg
00481791   1/1  .......................giqylhlpwpDhgvpdllellleflefieealeeggpvlVHCsaGvg
00468461   1/1  ----nlteevelgrlkcpnywpeleklgiqylhlpwpDhgvpdlelllellefirealkeggpvlVHCsa
00396141   1/1  ----------------------ytgwpdhgvppslellleflelvrealaelpkggpvlVHCsaGvgRtG
00431471   1/1  gdegsdyinasyldlyyipdrfiatqgplrntladfwrmlkelgithivnltellydpellerlgiqyly
00362821   1/1  gsdyinaspldlsyitprliagqgplafwemlkelgittvvmlleekelglykcinywpelredlerlgi
00418561   1/1  ---------------------qylylpwpDhgvpd..ldelldfieevleeggpvlVHCsaGvgRtgtlv
00492601   1/1  ----fidgyampfefiatqgpgpntladfwrmlkelgittivmltellelgklkceqyiqylhlpwpDhg
00379341   1/1  -----lllenldlddltrlvihyhylpwpdhgvPdspedlldfldevrefieellsllaldsggpvlVHC
00450981   1/1  ----------------------ylpwpdhgvpslpilksflellefirealkllaslllsslllldsggp
00454501   1/1  ----------------------ytgwpdhgvppsfeelldfielvrkaleelpkggpvlVHCsaGvgRtG
00421131   1/1  ----------------------ylpwpdhgvpdllellldflefvrkalaedsngpvlVHCsaGvgRtGt
00404391   1/1  ----------------------ytdwpdhgvppsfedlldfieavrkaleelpkggpvlVHCsaGvgRtG
00433361   1/1  ----------------------ylgwpdhgvpeslsllldflkavrealedsngpvlVHCsaGvgRTGtf
00404381   1/1  ----------------------ytgWpdhgvppspdllldfleavrealedpggpvlVHCsaGvgRtGtf
00369411   1/1  ----------------------ytgwpdhgvpespaslldfielvrkvlkllpsggpvlVHCsaGvgRsg
00510821   1/1  ---------------------evlhipildwpdpglplsfdavleflellld..kkngpvlvHCsaGkgR
00389341   1/1  ---------------------eylklpfpddgtvPsleillrfldlvdeflnedpggvvaVHCkaGlgRt
00479431   1/1  ----------------------ytgwpdhgvppslesllefielvrkalealpsngpvvVHCsaGvgRtg
00514291   1/1  seeErgrlkcdryw....pgirylhlpilddsaptilygalrvtllseellldyilrellltlllsagea
00512991   1/1  ----------------------ytnwpdhgvpdspellldflrlvrkalasgggpvvVHCsaGvgRtgtf
00468451   1/1  ----------------------ytswpdhgvppspedlleflrlvrellenlpgggpivVHCsaGvgRtG
00504321   1/1  ----------------------ytnWpdhgvPpspeilldflelvrksl.pggpivVHCsaGvGRtGtfi


                         -         -         -         -         *         -         -:420
query           IAYGLYKNTHLDFNAVYGMVKERSCWVGPNMSLIYQLTDFRTKIRGGTITRSPADYNEAMRTAQSSHTQT
00447631   1/1  vgRsgtlvaaylmkkl.glsleeaielvrerRp.ivpnpgqlrqLye-----------------------
00497721   1/1  Iatqgpleitvvdfreepvlyyngwrmvlrgdlnvrdivmsrde--------------------------
00480761   1/1  Rtgtlvaaylmlllg.vsleealelvrsqrpgavpnpgqlrflyefel----------------------
00481791   1/1  Rtgtlvaaylmkklg.lsleealalvrsrrpgavpnpgqlrfLl--------------------------
00468461   1/1  GigRtgtlvaayllelekglsveealalvreqRplgavqtpeQyrfly----------------------
00396141   1/1  tfiaaylmleqlekeggvdvleavkelreqRpgavqtpsqyrflydallellk-----------------
00431471   1/1  lpwpDhgvpllellleflefidellalspggpvlVHCsaGvgRt--------------------------
00362821   1/1  qylylpwpDhgvpdlsillefvkfveealsedpggpvlVHCsaGvgRtG---------------------
00418561   1/1  aaylmkkl.gvsleeavklvrsrRpgmvitpnqyfflqlallellllkktrpkl----------------
00492601   1/1  vpdlsqlllflllfieklaldkggpvlVHCsaGvgRtgtlvaaylml-----------------------
00379341   1/1  saGvgRtGtliaaylmllllgvdleeavkllreqRpgkavqtpsqy------------------------
00450981   1/1  vlVHCsaGvgRtGtlvaaylmlelleggvdlleavkelrsqRpglavqnle-------------------
00454501   1/1  tfiaaylmlrqlekegtlldvdlleavkllreqRpgavqn------------------------------
00421131   1/1  fiaaylmleqlekelgvsleeavkelrsqRpgavqtpsqy------------------------------
00404391   1/1  tfiaaylmleqlekelgvdleeavkllrsqRpgavqnpeqyrflyeal----------------------
00433361   1/1  ialyllleqlekeggvdleeavkelreqRpgavqtpsqyr------------------------------
00404381   1/1  iaaylmleqlekeggvdveeavkelreqRpgavqtpeqyr------------------------------
00369411   1/1  tfiaadlmlqqledklkeggvdileavkklReqRpgavqt------------------------------
00510821   1/1  TGtlvalylmllg..vsleealeeyrlkrpgvvqpnqqflfq----------------------------
00389341   1/1  GtlvaaY.LiyrlgmsaeeAialfrekRpgaipnqdyleallkrykelrkavlapekpelll--------
00479431   1/1  tfialdllldqlekeggvdvleavkllrsqRpgmvqt---------------------------------
00514291   1/1  revmhlhytdwpdhgvpqeallellellld.ggpvlvHCsaGkdRTGtvvallllllgvsletivdd---
00512991   1/1  ialdllleqlekeggvdvleavkrlreqRpgmvqtpe---------------------------------
00468451   1/1  tfialdllleqlekeglllgvdvleav-------------------------------------------
00504321   1/1  aldllleqlekeggvdvfeavkklReq-------------------------------------------


                         -         -         +         -         -         -         -:490
query           TDIEREIAHSKAAASTPNNGKPVVDPSKLFTQVNPFSPDTSSNRVRRHITPRPLPLREKFHTIHSLRNSP
00447631   1/1  ----------------------------------------------------------------------
00497721   1/1  ----------------------------------------------------------------------
00480761   1/1  ----------------------------------------------------------------------
00481791   1/1  ----------------------------------------------------------------------
00468461   1/1  ----------------------------------------------------------------------
00396141   1/1  ----------------------------------------------------------------------
00431471   1/1  ----------------------------------------------------------------------
00362821   1/1  ----------------------------------------------------------------------
00418561   1/1  ----------------------------------------------------------------------
00492601   1/1  ----------------------------------------------------------------------
00379341   1/1  ----------------------------------------------------------------------
00450981   1/1  ----------------------------------------------------------------------
00454501   1/1  ----------------------------------------------------------------------
00421131   1/1  ----------------------------------------------------------------------
00404391   1/1  ----------------------------------------------------------------------
00433361   1/1  ----------------------------------------------------------------------
00404381   1/1  ----------------------------------------------------------------------
00369411   1/1  ----------------------------------------------------------------------
00510821   1/1  ----------------------------------------------------------------------
00389341   1/1  ----------------------------------------------------------------------
00479431   1/1  ----------------------------------------------------------------------
00514291   1/1  ----------------------------------------------------------------------
00512991   1/1  ----------------------------------------------------------------------
00468451   1/1  ----------------------------------------------------------------------
00504321   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           CHDGPTATTATTTTTTTTTTTFQRPSVRSALQMDLVMQDVPPSPSFFSPKASEFIAAPFPRSKAGDITFE
00447631   1/1  ----------------------------------------------------------------------
00497721   1/1  ----------------------------------------------------------------------
00480761   1/1  ----------------------------------------------------------------------
00481791   1/1  ----------------------------------------------------------------------
00468461   1/1  ----------------------------------------------------------------------
00396141   1/1  ----------------------------------------------------------------------
00431471   1/1  ----------------------------------------------------------------------
00362821   1/1  ----------------------------------------------------------------------
00418561   1/1  ----------------------------------------------------------------------
00492601   1/1  ----------------------------------------------------------------------
00379341   1/1  ----------------------------------------------------------------------
00450981   1/1  ----------------------------------------------------------------------
00454501   1/1  ----------------------------------------------------------------------
00421131   1/1  ----------------------------------------------------------------------
00404391   1/1  ----------------------------------------------------------------------
00433361   1/1  ----------------------------------------------------------------------
00404381   1/1  ----------------------------------------------------------------------
00369411   1/1  ----------------------------------------------------------------------
00510821   1/1  ----------------------------------------------------------------------
00389341   1/1  ----------------------------------------------------------------------
00479431   1/1  ----------------------------------------------------------------------
00514291   1/1  ----------------------------------------------------------------------
00512991   1/1  ----------------------------------------------------------------------
00468451   1/1  ----------------------------------------------------------------------
00504321   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           KFANLQSPNLVRRPSMNDPRSPQRRAEPIIMRSIDEFL--------------------------------
00447631   1/1  ----------------------------------------------------------------------
00497721   1/1  ----------------------------------------------------------------------
00480761   1/1  ----------------------------------------------------------------------
00481791   1/1  ----------------------------------------------------------------------
00468461   1/1  ----------------------------------------------------------------------
00396141   1/1  ----------------------------------------------------------------------
00431471   1/1  ----------------------------------------------------------------------
00362821   1/1  ----------------------------------------------------------------------
00418561   1/1  ----------------------------------------------------------------------
00492601   1/1  ----------------------------------------------------------------------
00379341   1/1  ----------------------------------------------------------------------
00450981   1/1  ----------------------------------------------------------------------
00454501   1/1  ----------------------------------------------------------------------
00421131   1/1  ----------------------------------------------------------------------
00404391   1/1  ----------------------------------------------------------------------
00433361   1/1  ----------------------------------------------------------------------
00404381   1/1  ----------------------------------------------------------------------
00369411   1/1  ----------------------------------------------------------------------
00510821   1/1  ----------------------------------------------------------------------
00389341   1/1  ----------------------------------------------------------------------
00479431   1/1  ----------------------------------------------------------------------
00514291   1/1  ----------------------------------------------------------------------
00512991   1/1  ----------------------------------------------------------------------
00468451   1/1  ----------------------------------------------------------------------
00504321   1/1  ----------------------------------------------------------------------