[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_02186


[Show Plain Result]

## Summary of Sequence Search
   1::567
 120::303  3.5e-37 30.8% 0046490 00464901 1/1   inding domain                           
  99::301  7.5e-35 31.8% 0044931 00449311 1/1   inding domain                           
  79::303  7.6e-30 25.2% 0046342 00463421 1/1   inding domain                           
  95::301  1.5e-27 28.7% 0047282 00472821 1/1   inding domain                           
 116::301  2.6e-26 30.5% 0047231 00472311 1/1   inding domain                           
  90::303  7.9e-16 20.5% 0046672 00466721 1/1   inding domain                           
 109::320  2.5e-14 22.9% 0050017 00500171 1/1   inding domain                           
   1::567


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASQAEFVTPSAVNATMKASAVVGHRQRCSYGDSCWPTEGEWQSFNASVSGHLIRTYPSAAVCHAERYDD
00464901   1/1  ----------------------------------------------------------------------
00449311   1/1  ----------------------------------------------------------------------
00463421   1/1  ----------------------------------------------------------------------
00472821   1/1  ----------------------------------------------------------------------
00472311   1/1  ----------------------------------------------------------------------
00466721   1/1  ----------------------------------------------------------------------
00500171   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AKCTAAKENWLDSFWRTNQTGAYSAILWELGENGQCFIDSPRDAPCDQGIVPHYSVNIQSTSDIQTAVKF
00464901   1/1  -------------------------------------------------lllplalllllslalledlle
00449311   1/1  ----------------------------kilggdvvltdpadlaaystdwsglygglpaavvlPrsveev
00463421   1/1  --------llllllllaalledllealrailggevvltdeadllaystdllwsslygglplavvlPtste
00472821   1/1  ------------------------lllrlllpglvllddlllalytnwaglvgglplavvlPrsteevaa
00472311   1/1  ---------------------------------------------mealleellkllgegnvltdeslll
00466721   1/1  -------------------lealldeLrailgadnvltdpalllayatdaslyrglPlaVvlPrsteeva
00500171   1/1  --------------------------------------yslaklttfrigglpdavvlpesveevaallk


                         +         -         -         -         -         *         -:210
query           AAQKELYLTVKNTGHDHLGRSSGQGAFSLWTHNMKGREWHTSFIPKGAPQETTGIPAVTLQAGEQWLDVY
00464901   1/1  elrailggdnvltllssdpadllaystdastylpllllllllglPlavvrPesveevaaivklarehgip
00449311   1/1  aaavklarehalsglpvvvrggghsllggalpaggvvldlsrlnriellellevdpegg......tvtve
00463421   1/1  evaaivklanehgvpvvprgggtsllggalplgvdggvvldlsrmnrilevdpedl............tv
00472821   1/1  lvklaaehglpvvprGggtslsggavpdgslvlgglvlslsrlngilevdlsaedl..........tvtv
00472311   1/1  lttfdigglpdavvlPesteevaailklanehglpvvvrGggtnllggdvgfdgvvidlsrlnkieided
00466721   1/1  avlkacvelglpvvprgggtgltggavplgsdydrgvvvlslerlnrileid..egl..........tvv
00500171   1/1  lanehglpvlplGggsnllggd.lfdgvvi.lsrlngileide......pedlt....vtveAGvlladl


                         -         -         -         +         -         -         -:280
query           RAAAENGVIVVGGSARTVGAAGGYLTGGGHSPFSHFYGLAVDNLLEVNLVDANGTPRTINQYTDPEYFYA
00464901   1/1  vvprggGtsllvggsvplgrggvvidlsrllnkileidpegg............tvtveaGvtlgdlyea
00449311   1/1  aGvtlgdlyealaehglalpvdgslptvtv.GGliaggghgtlslryGltadnvlglevvladGevvtas
00463421   1/1  tVeaGvtlgdlyealaehgltlpvdpg.gsatigGvialtnagGlgsl..ryGltrdnvlglevvladGe
00472821   1/1  eAGvvladlaealakhglalpnlpsigsatiGGaiatnaggtglllgGglgllslrygllsdlvlglevv
00472311   1/1  ..............tvtvgaGvlladlvealaehgl...lgleplsgipg..tiGGaiatnaggyGletr
00466721   1/1  vepGvtladlnealaplgllfppdpgsagisatigGnvatnagGllvlrygatrdlvllalvdedgelel
00500171   1/1  vealaehglfgleplsgipgtiGGaiatnagg.....yGveirdlvlslevvdladgeiltlsaeklnfg


                         -         *         -         -         -         -         +:350
query           LRGGGGSAWGVITSVTYKTHPSPSHIQVGLVQFNVTNNSTLRAVIEKCLQELPSITDAGYTGYGSMNFLS
00464901   1/1  laehglelalpldpgscitvtvG-----------------------------------------------
00449311   1/1  asegydlfwalrgseg.tlGv-------------------------------------------------
00463421   1/1  vvrlgaellknsagydlfwalrg-----------------------------------------------
00472821   1/1  ladGevltlskdelgydlfqa-------------------------------------------------
00472311   1/1  dnvlslevvladGeivtls..-------------------------------------------------
00466721   1/1  vnhlglevvladgevldtlsglr-----------------------------------------------
00500171   1/1  yrls.lfkgseg.tlgiiteatlkllplpkavilalllel------------------------------


                         -         -         -         -         *         -         -:420
query           GGKEPLGFGAIFIQPNGTNATFTRTFKPYYDIAKMQGVSGALANIDFPSWIEYAEVFVQDPNIATNIIDG
00464901   1/1  ----------------------------------------------------------------------
00449311   1/1  ----------------------------------------------------------------------
00463421   1/1  ----------------------------------------------------------------------
00472821   1/1  ----------------------------------------------------------------------
00472311   1/1  ----------------------------------------------------------------------
00466721   1/1  ----------------------------------------------------------------------
00500171   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           SRLLTSQALLHRTRDLVDLMFEYASFGPGFNFIGKVSSAKRDETSTHPIWEQSRALLSFAANWRDDASAN
00464901   1/1  ----------------------------------------------------------------------
00449311   1/1  ----------------------------------------------------------------------
00463421   1/1  ----------------------------------------------------------------------
00472821   1/1  ----------------------------------------------------------------------
00472311   1/1  ----------------------------------------------------------------------
00466721   1/1  ----------------------------------------------------------------------
00500171   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           EKRNAKLSLVEISKKLGDIVGPGGGTYVNEANPYEPDWQNVFWGEKYARLLAIKKRIDPTNLFVCNRCVG
00464901   1/1  ----------------------------------------------------------------------
00449311   1/1  ----------------------------------------------------------------------
00463421   1/1  ----------------------------------------------------------------------
00472821   1/1  ----------------------------------------------------------------------
00472311   1/1  ----------------------------------------------------------------------
00466721   1/1  ----------------------------------------------------------------------
00500171   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           TDIVLEP---------------------------------------------------------------
00464901   1/1  ----------------------------------------------------------------------
00449311   1/1  ----------------------------------------------------------------------
00463421   1/1  ----------------------------------------------------------------------
00472821   1/1  ----------------------------------------------------------------------
00472311   1/1  ----------------------------------------------------------------------
00466721   1/1  ----------------------------------------------------------------------
00500171   1/1  ----------------------------------------------------------------------