[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_02196


[Show Plain Result]

## Summary of Sequence Search
   1::209
  35::209  8.5e-10 29.2% 0049311 00493111 1/1   CoA N-acyltransferases (Nat)            
  90::211    3e-08 20.8% 0046988 00469881 1/1   CoA N-acyltransferases (Nat)            
  78::211  3.7e-08 27.6% 0051437 00514371 1/1   CoA N-acyltransferases (Nat)            
  36::211  4.1e-08 24.6% 0053292 00532921 1/1   CoA N-acyltransferases (Nat)            
 129::209  5.2e-08 31.2% 0052522 00525221 1/1   CoA N-acyltransferases (Nat)            
 129::209  6.5e-08 28.8% 0049804 00498041 1/1   CoA N-acyltransferases (Nat)            
 122::208    9e-08 24.4% 0045986 00459861 1/1   CoA N-acyltransferases (Nat)            
 100::211  9.5e-08 19.3% 0051375 00513751 1/1   CoA N-acyltransferases (Nat)            
 103::209  1.3e-07 26.0% 0051492 00514921 1/1   CoA N-acyltransferases (Nat)            
  35::211  1.4e-07 24.4% 0053076 00530761 1/1   CoA N-acyltransferases (Nat)            
 120::211  1.9e-07 23.3% 0052874 00528741 1/1   CoA N-acyltransferases (Nat)            
  89::211  2.1e-07 22.5% 0051421 00514211 1/1   CoA N-acyltransferases (Nat)            
  35::211  2.4e-07 22.5% 0052713 00527131 1/1   CoA N-acyltransferases (Nat)            
  35::209  2.8e-07 25.2% 0049031 00490311 1/1   CoA N-acyltransferases (Nat)            
  89::211    3e-07 23.7% 0051420 00514201 1/1   CoA N-acyltransferases (Nat)            
 122::211  3.2e-07 23.3% 0052754 00527541 1/1   CoA N-acyltransferases (Nat)            
 122::211  5.6e-07 22.5% 0051751 00517511 1/1   CoA N-acyltransferases (Nat)            
  75::211    6e-07 22.5% 0051252 00512521 1/1   CoA N-acyltransferases (Nat)            
 121::209  6.7e-07 25.0% 0051915 00519151 1/1   CoA N-acyltransferases (Nat)            
 129::209  7.3e-07 25.3% 0051377 00513771 1/1   CoA N-acyltransferases (Nat)            
 103::211  7.6e-07 21.7% 0050223 00502231 1/1   CoA N-acyltransferases (Nat)            
  37::211  9.5e-07 27.0% 0048174 00481741 1/1   CoA N-acyltransferases (Nat)            
 120::211  9.7e-07 23.6% 0048433 00484331 1/1   CoA N-acyltransferases (Nat)            
 121::211  9.8e-07 24.4% 0050940 00509401 1/1   CoA N-acyltransferases (Nat)            
 121::211    1e-06 27.8% 0052664 00526641 1/1   CoA N-acyltransferases (Nat)            
  34::211  1.2e-06 21.4% 0052829 00528291 1/1   CoA N-acyltransferases (Nat)            
 129::211  1.2e-06 26.8% 0052347 00523471 1/1   CoA N-acyltransferases (Nat)            
 121::211  1.3e-06 29.1% 0051248 00512481 1/1   CoA N-acyltransferases (Nat)            
 129::211  1.6e-06 26.8% 0049641 00496411 1/1   CoA N-acyltransferases (Nat)            
  35::211  1.7e-06 23.5% 0048674 00486741 1/1   CoA N-acyltransferases (Nat)            
 122::211  2.1e-06 26.5% 0046177 00461771 1/1   CoA N-acyltransferases (Nat)            
 122::211  2.1e-06 25.6% 0051493 00514931 1/1   CoA N-acyltransferases (Nat)            
 121::211  2.5e-06 23.0% 0052701 00527011 1/1   CoA N-acyltransferases (Nat)            
  97::211  3.3e-06 20.4% 0049884 00498841 1/1   CoA N-acyltransferases (Nat)            
  81::211  3.7e-06 21.5% 0052040 00520401 1/1   CoA N-acyltransferases (Nat)            
 122::211  4.2e-06 23.9% 0050733 00507331 1/1   CoA N-acyltransferases (Nat)            
  78::210  4.7e-06 22.2% 0051232 00512321 1/1   CoA N-acyltransferases (Nat)            
 106::211  6.1e-06 22.0% 0051303 00513031 1/1   CoA N-acyltransferases (Nat)            
 121::211  7.2e-06 23.6% 0050185 00501851 1/1   CoA N-acyltransferases (Nat)            
 121::211  9.9e-06 23.2% 0048876 00488761 1/1   CoA N-acyltransferases (Nat)            
 129::209    1e-05 28.9% 0045896 00458961 1/1   CoA N-acyltransferases (Nat)            
  89::211  1.1e-05 24.4% 0046158 00461581 1/1   CoA N-acyltransferases (Nat)            
  98::209  1.8e-05 17.3% 0052858 00528581 1/1   CoA N-acyltransferases (Nat)            
  35::211  5.4e-05 22.6% 0047280 00472801 1/1   CoA N-acyltransferases (Nat)            
 121::211  7.1e-05 25.0% 0049032 00490321 1/1   CoA N-acyltransferases (Nat)            
 131::211  8.2e-05 33.3% 0043712 00437121 1/1   CoA N-acyltransferases (Nat)            
  89::209  0.00035 24.0% 0048084 00480841 1/1   CoA N-acyltransferases (Nat)            
   1::209


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRLCSRQLCVSCAIYAESSTPYACHAGLTAPIYAPSFHIHPVRSPRDIATATSLIKSYTDSLGIDLSYQD
00493111   1/1  ----------------------------------mrltirpat.peDleallallaeafpelgeplslee
00469881   1/1  ----------------------------------------------------------------------
00514371   1/1  ----------------------------------------------------------------------
00532921   1/1  -----------------------------------rltirpa.tpeDleallallndafveeyaglpppl
00525221   1/1  ----------------------------------------------------------------------
00498041   1/1  ----------------------------------------------------------------------
00459861   1/1  ----------------------------------------------------------------------
00513751   1/1  ----------------------------------------------------------------------
00514921   1/1  ----------------------------------------------------------------------
00530761   1/1  ----------------------------------mdltirpa.tpeDlpailallaeafaeelalllp.e
00528741   1/1  ----------------------------------------------------------------------
00514211   1/1  ----------------------------------------------------------------------
00527131   1/1  ----------------------------------erltirpat.peDleallellneafveeflplslee
00490311   1/1  ----------------------------------erltirpat.peDleallallneafeallgllpppt
00514201   1/1  ----------------------------------------------------------------------
00527541   1/1  ----------------------------------------------------------------------
00517511   1/1  ----------------------------------------------------------------------
00512521   1/1  ----------------------------------------------------------------------
00519151   1/1  ----------------------------------------------------------------------
00513771   1/1  ----------------------------------------------------------------------
00502231   1/1  ----------------------------------------------------------------------
00481741   1/1  ------------------------------------yltirpat.peDleallallreafve..ppesle
00484331   1/1  ----------------------------------------------------------------------
00509401   1/1  ----------------------------------------------------------------------
00526641   1/1  ----------------------------------------------------------------------
00528291   1/1  ---------------------------------mmditirpa.tpedleallallaeafaeelallll..
00523471   1/1  ----------------------------------------------------------------------
00512481   1/1  ----------------------------------------------------------------------
00496411   1/1  ----------------------------------------------------------------------
00486741   1/1  ----------------------------------mmeiirpltpadldallellaaagpadglavvellv
00461771   1/1  ----------------------------------------------------------------------
00514931   1/1  ----------------------------------------------------------------------
00527011   1/1  ----------------------------------------------------------------------
00498841   1/1  ----------------------------------------------------------------------
00520401   1/1  ----------------------------------------------------------------------
00507331   1/1  ----------------------------------------------------------------------
00512321   1/1  ----------------------------------------------------------------------
00513031   1/1  ----------------------------------------------------------------------
00501851   1/1  ----------------------------------------------------------------------
00488761   1/1  ----------------------------------------------------------------------
00458961   1/1  ----------------------------------------------------------------------
00461581   1/1  ----------------------------------------------------------------------
00528581   1/1  ----------------------------------------------------------------------
00472801   1/1  ----------------------------------mterltirpa.tpeDlpallallreafveeellpdl
00490321   1/1  ----------------------------------------------------------------------
00437121   1/1  ----------------------------------------------------------------------
00480841   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FSTEISQMPGKYAPEKGGEILLAIQNNSTSDNFYEPVHAEESHGGSVSPRKNYCCSCTYVESDVLGCAAL
00493111   1/1  lrellad........pgalllvaeddg...................................elvGfagl
00469881   1/1  -------------------mtiRpatpeDlpelldallallrdafaellalllpeplseeeleellerll
00514371   1/1  -------Meirirpa.dledllallreafveefallppplsledlrelled.pgalflvaeddgelvGfa
00532921   1/1  sleelrellae......adpgalflvaedakedgepgepe..............................
00525221   1/1  ----------------------------------------------------------eedgelvGfaal
00498041   1/1  ----------------------------------------------------------eddgeivGfagl
00459861   1/1  ---------------------------------------------------galllvaeddgelvGfagl
00513751   1/1  -----------------------------dltirpatpeDleallalladafveeylllfppplsleelr
00514921   1/1  --------------------------------HltirpatpeDleallallndafveeylllppplteee
00530761   1/1  eplsleelaall..apgalllvaeddg...................................elvGfall
00528741   1/1  -------------------------------------------------dpgslflvaeddgelvGfagl
00514211   1/1  ------------------tiRpatpeDleallallndafveeyllpfppplsleeleerlrelladgdg.
00527131   1/1  lrefled...........................................pgalllvaeddgelvGfagl
00490311   1/1  leellerlle...adpgglllvaedkedg...................................elvGfa
00514201   1/1  ------------------Pedleallallrelfeaplseeeseelleelledg....lflvaeddgelvG
00527541   1/1  ---------------------------------------------------plptleterltlRpatpeD
00517511   1/1  ---------------------------------------------------galflvaeddgelvGfall
00512521   1/1  ----mmditirpatpedleallelllelfpeeysleelle.........lpgalllvaeddgeivGfall
00519151   1/1  --------------------------------------------------pgalvlvaedleelldkedg
00513771   1/1  ----------------------------------------------------------eddgelvGfagl
00502231   1/1  --------------------------------mitirpapeDlpallallreafvellallllaplseel
00481741   1/1  dleelladppal........llvaeddge...................................lvGfag
00484331   1/1  -------------------------------------------------gmpptleterltlRpatpeDa
00509401   1/1  --------------------------------------------------mmdmsditirpatpeDleal
00526641   1/1  --------------------------------------------------pgglflvaeddgelvGfagl
00528291   1/1  ..................................................pgalllvaeddgeivGfall
00523471   1/1  ----------------------------------------------------------eddggelvGfag
00512481   1/1  --------------------------------------------------pgglllvaeddgeivGfaal
00496411   1/1  ----------------------------------------------------------eddgelvGfagl
00486741   1/1  llellgplldrgtlfvalddgelvGfialipygepfafigllivhpdyrgrGigralleaalerlpgrpl
00461771   1/1  ---------------------------------------------------kmiemrltirpatpeDlea
00514931   1/1  ---------------------------------------------------glmslmtmditirpatpeD
00527011   1/1  --------------------------------------------------ltlrpltpedaeallallnd
00498841   1/1  --------------------------rltirpatpeDleallallndafvelylglllllafelaplsle
00520401   1/1  ----------IR.atpedleallellreafpeeylllllelllell.....pgalflvaeddgelvGfar
00507331   1/1  ---------------------------------------------------galllvaeddgelvGfagl
00512321   1/1  -------itirpatpedleallelllevfpepyseelledlld.......psalvlvaeddgelvGfarl
00513031   1/1  -----------------------------------mltirpatpeDleallallreafavlgaelpppsl
00501851   1/1  --------------------------------------------------pgglflvaededgelvGfag
00488761   1/1  --------------------------------------------------Miiirpatpedleailallr
00458961   1/1  ----------------------------------------------------------eddgelvGfarl
00461581   1/1  ------------------pttmritirpatpeDleallallreafvelpldpplsledlrelledp.gal
00528581   1/1  ---------------------------mmnitirpatpeDleailellreafrdtyafllspevlealgf
00472801   1/1  eplsleelralleallalllldpgalflvaedeedg..................................
00490321   1/1  --------------------------------------------------pgalflvaeddgelvGfarl
00437121   1/1  ------------------------------------------------------------dgelvGfagl
00480841   1/1  ------------------plpmmllmmditirpatpedldallallaaafpepfseafaeelldg.....


                         +         -         -         -         -         *         -:210
query           RNLPSINPLRICEIKRLYILPRARSLGYRQGAYQMQLSTRPGRKGYAEMRLDTLPTMHSAIALYKSLGF-
00493111   1/1  slldslllgldgggvaeieglyVlpeyrgrGiGraLlaallewarer.GarrlvlevlpdNtaairlYe-
00469881   1/1  edladpgalflvaeddgelvGfaglrpdddepggpvaeigylavdpeyrgkGiGraLlealleyarel.g
00514371   1/1  alrpld....ggvaeigrlavdpeyrgkGiGraLleallelarer.glrrlvlevlvlpdNeaairlyek
00532921   1/1  lvGfaglrpidspggggvaeigylavdpeyrgkGiGraLlealleyarel.glkrivlevlpdNeaairl
00525221   1/1  slldstlagrdvaeiedlyVapeyrgqGiGkaLleallelarer.gakrlrlevladNeaAirlYeklG-
00498041   1/1  rpddsglagdllgllllglllllglllllllllpgggvaeigrlaVdpeyrGkGiGraLlealleyare-
00459861   1/1  rplddlplgldvaeigdlavdpeyrgkGiGraLleallelarel.glkrlvlevladNeaairlYekl--
00513751   1/1  alleella..pgslllvaeddgelvGfaglrpiddepgggvaeigglavdpeyrgkGigtallealleya
00514921   1/1  slerlrelladp..gslllvaeddgelvGfaglrpldslllpgggvaeigglavdpeyrgkGiGraLle-
00530761   1/1  lplds...gdvaelgdlaVapearGrGiGraLlealeelarerlgarrlrlevledNaaaialYeklGFe
00528741   1/1  rpiddeplggvaei.glavdpeyrgkGiGtallealleyarel.glkrivlevdpdNeaairlyeklGFe
00514211   1/1  llvaeddtgelvGfaglrpiddgplglgvaei.glavdpeyrgkGiGtaLlealleyare.lglrrlvle
00527131   1/1  slidp....gtaeigrlavdpeyrgkGiGkallealleyakerlglkrlylevledNeaairlYeklGFv
00490311   1/1  glrpidslllgggvaeigylavdpeyrgkGiGraLlealleyarel.glkrlvlevlpdNeaairlYek-
00514201   1/1  faglrpdd....ggvaeigrlavdpeyrgkGiGraLlealleyare.lglrrlvlevladNeaairfYek
00527541   1/1  leallallndaevellggplspedleeflerllerladpgalllvaedkedgelvGfvglrpid...egg
00517511   1/1  spidslpgggtaeieglaVdpeyrgkGiGsaLleallelare.lglkrlylevladNeaairfYeklGFv
00512521   1/1  rplg.....dvaeierlaVdpeyrgkGiGsaLlealeelaker.gcrrlllevl..neaairfYeklGFe
00519151   1/1  eivGfallrldystpggkvayiedlyVlpeyrgkGiGkaLlealeelaker.gckrlylevledNepai-
00513771   1/1  rpid..agegvaeigylavdpeyrGkGiGtallealleyafrelglrrlvlevdadNeaairlyeklGF-
00502231   1/1  slerlrellad.pgglllvaedddGelvGfaglrpdddlplgggvaeigdlavdpeyrgkGiGraLleal
00481741   1/1  lrpldde..grvaeigylavdpeyrgkGiGraLlealleyare.lglrrlvlevlpdNeaairlyeklGF
00484331   1/1  eallallreadpevarllpflgpplsleelraflerllaaealdpgglflvaeddgelvGfaglrpidde
00509401   1/1  lallreafpeeeplsledlralledpgalflvaeddgelvGfarlrpdddlp..dvaeigrlaVdpeyrg
00526641   1/1  rpldslllgggvaeigglavdpeyrgkGiGraLlealleyarer.glrrlvlevlpdNeaairlYeklGF
00528291   1/1  lplg.....gvayieslaVdpeyrgqGiGraLleaaeeearer.glkrlylevd..npaairlYeklGFe
00523471   1/1  lrpiddgpggklvaeigglavdpeyrGkGiGtaLlealleyarer.glrrlvlevdpdNeaairlYeklG
00512481   1/1  lpld...p.dvaeigrlaVapeyrgkGiGkaLleallelarel.glkrlvlevladntaaialYeklGFe
00496411   1/1  rpldsllalpgggvaeigylavdpeyrgkGiGraLlealleyare.lglrrlvlevdpdNeaairfYekl
00486741   1/1  vllpeanpallalleklgfrlarellrmqldlpplpppleterltiRpatperDleallallaeafveey
00461771   1/1  llellreafaefypelpplsleelrelladpgalflvaeddgelvGfarlrpdgde...rvaeigrlaVd
00514931   1/1  leallellrevfpeelpplsleelrelladpgalflvaeddgelvGfarlrplpdg....gvaeigrlaV
00527011   1/1  afvalyllgpppplsleelrerleedlgggllfvaeddgelvGfvglrpdpdg...gvaeigylavlpdy
00498841   1/1  ellerlrelladggalllvaeddgeplvGfaglrpidse.gggvaeigglavdpeyrgkGiGraLleall
00520401   1/1  lrpldsllllgggvaeigrlavdpeyrgkGiGraLleallelarel.glkrlvlev...npaairfYekl
00507331   1/1  rpdddetgggrpvaeigylavdpeyrgkGiGraLlealleyarel.g.rrlvlevladNeaairlYeklG
00512321   1/1  ipdg....gdvaeigdlaVlpeyrgkGiGsaLlealleyakel.glkriylevladn.paiklYeklGFv
00513031   1/1  eellerllddpgllflvaeddgelvGfarlrpdgdep...vaeigrlaVdpeyrgkGiGraLlealleya
00501851   1/1  lrpiddgpagggvaei.glavdpeyrgkGigtallealleyare.lglrrlvlevdpdNeaairlyeklG
00488761   1/1  evfpeelplsleelrdlldpgalllvaeddgelvGfarllp.....ggdvaeigrlaVdpeyrgkGiGra
00458961   1/1  rpl...pggdvaeigrlaVdpeyRGkGiGraLlealleearer.glkriylevledNeaadeslirfYe-
00461581   1/1  llvaeddgelvGfarlrpldsllllllllllllpggdvaeigrlavdpeyrgkGiGraLleallelarer
00528581   1/1  deglplseaeslerlrelledpgglflvaeddgkivGfialspdgvlllglllllsllpggkvaeigrl-
00472801   1/1  .elvGfaglrplpdpvlglggvaeigdlavdpeyrgkGiGraLleallelarel.glrrlvlev...nea
00490321   1/1  rpl...pggdvaeigrlavdpeyrgkGiGraLlealleeare.lglkrlvlev...neaairfYeklGFe
00437121   1/1  s..pg......aelgalyVlPeyrgrGlGraLlaallerarar.GarrltlevladNeaaialYeklGFe
00480841   1/1  ....lvlvaeddgrvvGfaallplrlliggrggrvgyiegvaVhpdyRGqGlGsaLldaaeeeare..g-