[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_02520


[Show Plain Result]

## Summary of Sequence Search
   1::424
  63::358 1.6e-115 48.5% 0053136 00531361 1/1   like                                    
  49::362 1.2e-112 47.3% 0053137 00531371 1/1   like                                    
  59::363 8.3e-112 48.2% 0052839 00528391 1/1   like                                    
   1::424


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASLPLPSSTSHKPTASLDLSKKLSSLRTNRRNPSALSSQAAAPPTPQLPDRPTLTQHQFIRPVPRILSP
00531361   1/1  --------------------------------------------------------------Pekrilsp
00531371   1/1  ------------------------------------------------sleelsllslefllPekrilsp
00528391   1/1  ----------------------------------------------------------efllPekrilsp


                         -         -         *         -         -         -         -:140
query           QDLETFLSSPAHSLIIAFVFNVSDSVRQQSVSSLVQLPVSETIRKVLSILSAIEELIDKHPSLDQNGSRF
00531361   1/1  edlelflsseayadllafilslnesvvglklsdll.ldlselvekllelldkleklidetppleqalpsr
00531371   1/1  edlelflsseayadilafilslnesvkglklsdlllelslseivekllelldkleslidetPpleq.psr
00528391   1/1  edlelflsseayadllafilslsesvkglklsdll..llseivekllelldkleslidetppleq.psrf


                         +         -         -         -         -         *         -:210
query           GNPAFRDLFDDIAAHSVQWHKDILGLDDPAAIEEVSTYLIHSLGSRSRLDFGSGHELNFMMWLLCLYLFG
00531361   1/1  fGnlafrtwldkleeelddlleellpellseallelsvYllnsfGnstrlDYGtGhelnFlafllcllkl
00531371   1/1  fGnlafrtwldkleeelldllkellpeelseallelsvYllnsfGnstrlDYGtGhelnFlafllcllkl
00528391   1/1  GnlafrtwldkleeelldlleellpellseallelsvYllnsfGnstrlDYGtGhElnFlafllcllklg


                         -         -         -         +         -         -         -:280
query           MLDRNDFPVIVCHVFIRYMKLMRHVQTTYYLEPAGSHGVWGLDDYHFIPFLFGAAQLTGHPYITPLAIHN
00531361   1/1  glleeedllealvllvflkYlelvrrlqltYtlePAGshGvWGLddyqflPflfGaaqllghkllkPksi
00531371   1/1  gllte.dlralvllvflkYlelvrrlqltYtlePAGshGvWGLDdyqflPflfGaaqllggslhkllkPk
00528391   1/1  lldeedlealvllvfvkYlelvrrlqltYtlePAGshGvWGLddyqflPflfGaaqllghkllkPksild


                         -         *         -         -         -         -         +:350
query           NVVLDEEGDNWIYLDQVRWVDSVKTVKGLRWHSPMLDDISGAKNWYKVEAGMKKMFVKEVLGKLPIMQHF
00531361   1/1  ldeelveeysdeylylsaiafinkvktvgpfaehspmLydisgvksWskvnsGllkmylaevlsklpvvq
00531371   1/1  sildeelveeysdeylylsaiafinkvktg.pfrehspmLydisglvksWskvnsGllkmylaevLsklp
00528391   1/1  eelveeysdeylylsaiafinkvktg.plaehspmLydisgvksWskvnsGllkmylaevlsklpvvqhf


                         -         -         -         -         *         -         -:420
query           LFGSLIPALPEMGERNEKAEQPDPGSGHPHGHAHSHQNDFWGDCCGIKVPSAVAAGEEMRKRQGGTGLRP
00531361   1/1  hflfGsll--------------------------------------------------------------
00531371   1/1  vvqhflfGslls----------------------------------------------------------
00528391   1/1  lfGsllsleedls---------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           IPFD------------------------------------------------------------------
00531361   1/1  ----------------------------------------------------------------------
00531371   1/1  ----------------------------------------------------------------------
00528391   1/1  ----------------------------------------------------------------------