[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_02554


[Show Plain Result]

## Summary of Sequence Search
   1::149
   2::144  6.8e-51 49.7% 0036299 00362991 1/1   ic acid-binding proteins                
  13::113  7.1e-35 48.5% 0047679 00476791 1/1   ic acid-binding proteins                
  26::95   2.9e-23 41.4% 0047223 00472231 1/1   ic acid-binding proteins                
  27::96   1.4e-21 38.6% 0045777 00457771 1/1   ic acid-binding proteins                
  32::98     1e-09 36.9% 0044179 00441791 1/1   ic acid-binding proteins                
   1::149


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPKNKGKGGKNRRRGKNENDNEKRELTFKEEGQEYAQVVKMLGNGRLEALCFDGEKRLAHIRGKLRKKVW
00362991   1/1  -pknkgkggknkrrvknenevtlvelakeeeievigvVvkllgnglfevlledgverlahipgkmRkniw
00476791   1/1  ------------lkrknvteellvelvlkeegeviavVlellgnnlfeveledgverlaripgklrkriw
00472231   1/1  -------------------------lakeelievlgvvlellgnglfrvllengvevlahisGklrknli
00457771   1/1  --------------------------akeelievlgvvlellgnglfrvllengveilahisGklrkrli
00441791   1/1  -------------------------------ieleGlvvellgnfyfvvllengllllchlrgklrknki


                         -         -         *         -         -         -         -:140
query           INQGDIILLSLRDYQDEKGDVILKYSADEARSLKAYGELPESAKINETDTYGHEGLDDNVEFDEDRESAD
00362991   1/1  ilrGDiVlvelseydktkgeIiyrytddevkllkkegelpelfkinetdvageseddelnveddessdee
00476791   1/1  ileGdiVlvelsdyddkvkgdIiyrytddevkllkkegelpee---------------------------
00472231   1/1  rileGDivlvelspydltkgriiyr---------------------------------------------
00457771   1/1  rilvGDivlvelspydltkgrivyry--------------------------------------------
00441791   1/1  rilvGDrVelspydl..gkgrIverlpr------------------------------------------


                         +         -         -         -         -         *         -:210
query           EKDIDIDEI-------------------------------------------------------------
00362991   1/1  dddl------------------------------------------------------------------
00476791   1/1  ----------------------------------------------------------------------
00472231   1/1  ----------------------------------------------------------------------
00457771   1/1  ----------------------------------------------------------------------
00441791   1/1  ----------------------------------------------------------------------