[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_02566


[Show Plain Result]

## Summary of Sequence Search
   1::287
   7::284  6.5e-27 26.0% 0046793 00467931 1/1   /beta-Hydrolases                        
  13::287  1.3e-19 22.2% 0045824 00458241 1/1   /beta-Hydrolases                        
   5::289  6.4e-17 20.0% 0048633 00486331 1/1   /beta-Hydrolases                        
  22::288  2.2e-16 19.0% 0053045 00530451 1/1   /beta-Hydrolases                        
  20::284    7e-16 19.0% 0047940 00479401 1/1   /beta-Hydrolases                        
  15::283  1.1e-15 21.3% 0050245 00502451 1/1   /beta-Hydrolases                        
   9::283  4.1e-15 23.9% 0047003 00470031 1/1   /beta-Hydrolases                        
  27::284  4.3e-15 24.1% 0050226 00502261 1/1   /beta-Hydrolases                        
   3::283  1.6e-14 22.1% 0047601 00476011 1/1   /beta-Hydrolases                        
  12::284  2.4e-14 24.9% 0048053 00480531 1/1   /beta-Hydrolases                        
   1::283  2.7e-14 21.7% 0051883 00518831 1/1   /beta-Hydrolases                        
  15::284  4.4e-14 18.8% 0048982 00489821 1/1   /beta-Hydrolases                        
  14::287    1e-13 24.3% 0046639 00466391 1/1   /beta-Hydrolases                        
  22::284  1.2e-13 21.4% 0048945 00489451 1/1   /beta-Hydrolases                        
   4::285  2.2e-13 22.5% 0049887 00498871 1/1   /beta-Hydrolases                        
  20::283  2.4e-13 20.0% 0048207 00482071 1/1   /beta-Hydrolases                        
  22::285  3.3e-13 19.1% 0048460 00484601 1/1   /beta-Hydrolases                        
  14::285  3.9e-13 20.0% 0049383 00493831 1/1   /beta-Hydrolases                        
  15::282    7e-13 23.0% 0049128 00491281 1/1   /beta-Hydrolases                        
  13::286  8.4e-13 18.0% 0047627 00476271 1/1   /beta-Hydrolases                        
   9::289  1.3e-12 21.1% 0047600 00476001 1/1   /beta-Hydrolases                        
  20::287  3.8e-12 21.1% 0046670 00466701 1/1   /beta-Hydrolases                        
  15::287  4.8e-12 19.7% 0047764 00477641 1/1   /beta-Hydrolases                        
   6::285  7.5e-12 18.8% 0047388 00473881 1/1   /beta-Hydrolases                        
  21::285  9.1e-12 17.0% 0049631 00496311 1/1   /beta-Hydrolases                        
  14::282  1.6e-11 20.0% 0045851 00458511 1/1   /beta-Hydrolases                        
  17::284  1.9e-11 16.8% 0049087 00490871 1/1   /beta-Hydrolases                        
  26::287  5.4e-11 22.3% 0047317 00473171 1/1   /beta-Hydrolases                        
   5::284  1.1e-10 22.3% 0036443 00364431 1/1   /beta-Hydrolases                        
  20::284  2.9e-10 21.1% 0053348 00533481 1/1   /beta-Hydrolases                        
  14::284  3.6e-10 18.8% 0048194 00481941 1/1   /beta-Hydrolases                        
  14::288  4.3e-10 19.9% 0050206 00502061 1/1   /beta-Hydrolases                        
  19::284  4.3e-10 21.1% 0047200 00472001 1/1   /beta-Hydrolases                        
  22::284    5e-10 19.0% 0047683 00476831 1/1   /beta-Hydrolases                        
 110::284  5.8e-10 25.6% 0039526 00395261 1/1   /beta-Hydrolases                        
 112::284  6.5e-10 24.5% 0041193 00411931 1/1   /beta-Hydrolases                        
  14::284  9.9e-10 20.0% 0046077 00460771 1/1   /beta-Hydrolases                        
  13::237  1.3e-09 24.0% 0047034 00470341 1/1   /beta-Hydrolases                        
  14::282  2.7e-09 20.9% 0049037 00490371 1/1   /beta-Hydrolases                        
  20::284  2.8e-09 20.0% 0046410 00464101 1/1   /beta-Hydrolases                        
  26::286  3.2e-09 19.6% 0048965 00489651 1/1   /beta-Hydrolases                        
  26::283  9.2e-09 19.4% 0047444 00474441 1/1   /beta-Hydrolases                        
   8::284    1e-08 17.2% 0047194 00471941 1/1   /beta-Hydrolases                        
  25::283  1.1e-08 18.9% 0044560 00445601 1/1   /beta-Hydrolases                        
 110::284  1.8e-08 27.7% 0050947 00509471 1/1   /beta-Hydrolases                        
  23::284  2.4e-08 17.6% 0050112 00501121 1/1   /beta-Hydrolases                        
  15::288  2.8e-08 19.4% 0045984 00459841 1/1   /beta-Hydrolases                        
  17::285  2.8e-08 19.2% 0046221 00462211 1/1   /beta-Hydrolases                        
 128::284  5.6e-08 26.2% 0048825 00488251 1/1   /beta-Hydrolases                        
  15::284  6.5e-08 17.7% 0045886 00458861 1/1   /beta-Hydrolases                        
  22::243  6.9e-08 21.2% 0043326 00433261 1/1   /beta-Hydrolases                        
  14::288  7.3e-08 18.0% 0048075 00480751 1/1   /beta-Hydrolases                        
 128::284  8.3e-08 21.2% 0045736 00457361 1/1   /beta-Hydrolases                        
 120::283  8.4e-08 20.8% 0039602 00396021 1/1   /beta-Hydrolases                        
 112::284    1e-07 22.9% 0045186 00451861 1/1   /beta-Hydrolases                        
  26::285  1.2e-07 18.9% 0046573 00465731 1/1   /beta-Hydrolases                        
  23::284  1.3e-07 17.1% 0046004 00460041 1/1   /beta-Hydrolases                        
  26::284  1.4e-07 19.4% 0051001 00510011 1/1   /beta-Hydrolases                        
 116::285  1.9e-07 17.8% 0047495 00474951 1/1   /beta-Hydrolases                        
 128::283  2.3e-07 19.6% 0042551 00425511 1/1   /beta-Hydrolases                        
 112::261  5.7e-07 20.9% 0049928 00499281 1/1   /beta-Hydrolases                        
   8::284  5.8e-07 18.5% 0045742 00457421 1/1   /beta-Hydrolases                        
 112::284  8.8e-07 21.6% 0039914 00399141 1/1   /beta-Hydrolases                        
  13::238    1e-06 18.2% 0046624 00466241 1/1   /beta-Hydrolases                        
  26::284  1.6e-06 17.3% 0045741 00457411 1/1   /beta-Hydrolases                        
 116::284  2.4e-06 24.8% 0041128 00411281 1/1   /beta-Hydrolases                        
  14::185  2.7e-06 20.1% 0046012 00460121 1/1   /beta-Hydrolases                        
  14::182  2.9e-06 19.4% 0047220 00472201 1/1   /beta-Hydrolases                        
 120::287  4.1e-06 23.3% 0049630 00496301 1/1   /beta-Hydrolases                        
  24::282  6.9e-06 19.6% 0041081 00410811 1/1   /beta-Hydrolases                        
 112::284  1.1e-05 24.2% 0048935 00489351 1/1   /beta-Hydrolases                        
  20::278  1.7e-05 18.4% 0047879 00478791 1/1   /beta-Hydrolases                        
   4::182  3.9e-05 18.1% 0048008 00480081 1/1   /beta-Hydrolases                        
  19::283  7.3e-05 18.2% 0037239 00372391 1/1   /beta-Hydrolases                        
 116::283  7.8e-05 23.1% 0042339 00423391 1/1   /beta-Hydrolases                        
 128::284  7.8e-05 20.7% 0049094 00490941 1/1   /beta-Hydrolases                        
 220::283  0.00011 28.8% 0048003 00480031 1/1   /beta-Hydrolases                        
   9::239  0.00015 20.0% 0046126 00461261 1/1   /beta-Hydrolases                        
 110::261  0.00024 19.4% 0048126 00481261 1/1   /beta-Hydrolases                        
 118::261  0.00037 21.8% 0048675 00486751 1/1   /beta-Hydrolases                        
 115::273  0.00039 20.6% 0047592 00475921 1/1   /beta-Hydrolases                        
 116::275  0.00043 20.3% 0046202 00462021 1/1   /beta-Hydrolases                        
 110::270  0.00099 21.6% 0046502 00465021 1/1   /beta-Hydrolases                        
   1::287


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MALNMEAENRTFPDLHIVEPQAPHTHTAIFLHGRGSNGPEFTEDLFSSKTSGGQDLPSLFPSWRWVFPSS
00467931   1/1  ------tvdglrlpyrlylpaggggpkplvvllHGlggsgadwrp........laralae..agfrvvap
00458241   1/1  ------------MrlylylppgggplpvvvllHGgggsaeswrp........laealaerlpgyvvvapd
00486331   1/1  ----lpveevtipspdgdrlplrlylPagyapggklPvvvllHGgggsseswalfgrplaralaaraGya
00530451   1/1  ---------------------lPellslpgvtveevtvptpdgvrlplrlylPagpggklPvvvllHGgg
00479401   1/1  -------------------vgllsldldllllsysslttpsdlylfddlllaelelllltalllpelfdl
00502451   1/1  --------------asfsldldllllsysspttppelylfldllllellllplltlldpllfdlpgveve
00470031   1/1  --------rlpallalllllaallaslpappggtveevtipsrdgdr.plrvylPagydpggklPvvvll
00502261   1/1  --------------------------dgmsepvtitseDglylnvtltlpeispgpkPvvvflHGGgfll
00476011   1/1  --lgllPvgelRfkaPvplepwpacpqllslllpgllinkllekllrslldpepgvevedvtiptsdgrl
00480531   1/1  -----------pwsgvldllllllllllllllllllllllatkfgpacpqpvdlyppgvevedvtipspd
00518831   1/1  llellslkpvpggtlevltfkstalgrerrvlvylPpgypgggyPvlvllhGlggsgrswapralaqlla
00489821   1/1  --------------llllllllllllllllllvlllllllkllepllnpveertvtvdglrlhyrlygpg
00466391   1/1  -------------kpPvlaagagelrfkppepwsllgvldatllgplcpqllpppgvevedvtipgsdgr
00489451   1/1  ---------------------dlpgvpveevtiptpdGvrlplrlylPagadpggklPvvvllHGgggss
00498871   1/1  ---eevrteiltldglrlyyppgggklPvvvllHGgggsaeswrp...laealaerGyrvvapdyrghge
00482071   1/1  -------------------lallllllltlllpallpppgvpveevtvptpdGvrlhyrlylPagggklP
00484601   1/1  ---------------------fkllllllllllltlllpplppppgvpveevtvptpdGvrlhyrlygPp
00493831   1/1  -------------llpipalyvvelvffstvdgdklplrvylpkg.klPvvvllhGgggssgsaswspyg
00491281   1/1  --------------alpvevetvtvpvdgdclhl.vylPalP..avvvllhGgggsagsaslelyrglar
00476271   1/1  ------------Ggpdglr.ayllpgpgsgppvvllHGlggsaeswrp..laraLa...gyrvvavdlrG
00476001   1/1  --------gllllllalllaslpslpggtveevtvtspvdgdtlplrvylPagydpggplPvvvllHGgg
00466701   1/1  -------------------sspggpvveesvtstvdgdrlplrvylPagag.PvvvllHGgggsagspsw
00477641   1/1  --------------lfdplllfdpevlldiselisklgypveevtvttedGltlplylylpptygelggg
00473881   1/1  -----allvpveevtvtvdglrlayrlygppggpklpvvlllHGlggsseswrpla.laealaarGyrvv
00496311   1/1  --------------------maldllvtvttpdGvrlayrlylPagagpkkgppvvllHGgggsseswrp
00458511   1/1  -------------lrllepllvpveertvttpdGlrlhyreygppsgppvvllHGlggsseswr.....a
00490871   1/1  ----------------PPyrpsgggpgppvvllHGgggssesw........rplaealaerGyrviapdl
00473171   1/1  -------------------------HppvlllHGlggsaeswrplaealaeaGypdvrviapdlrghgls
00364431   1/1  ----lpvetvtiptgdgrlpaylylPagagpapvvvllhglggssasf...rplaralaarGyavlapdl
00533481   1/1  -------------------erype.pgp.pvvllHGlggsaeswwlpsswrplaeaLaeaGyrviapdlr
00481941   1/1  -------------gslllalllrllellkldlllellllllklellleplevefvdvdglrlhypppggg
00502061   1/1  -------------lPeelplvpfeertvttpdGlrlhyreag.dg.ppvvllHGlggssesw.rpla..p
00472001   1/1  ------------------dlellldisellkklgvpveevtvttpdGvrlhyrlylpkpppppgggpgpp
00476831   1/1  ---------------------dlppveevtvttpdGvrlhyrlylPpgggplPvvvllHGgggssgsw.r
00395261   1/1  ----------------------------------------------------------------------
00411931   1/1  ----------------------------------------------------------------------
00460771   1/1  -------------elpfeertvtvdglrlhyleagpgdkppvvllHGlgpGpgssesw..rplapaLae.
00470341   1/1  ------------mkillillllllllllliglllrplsrllllpalenllfllytplnpeevrfvtvdgl
00490371   1/1  -------------lrllepllypfeeryvtvpdGlrlhyreygppsgppvlllHGlggssesw....pla
00464101   1/1  -------------------PpgggsgppvvllHGlggssesw........rplaeaLaarGyrviapDlr
00489651   1/1  -------------------------ggaalvllHGlggssesw.rplapaLaerG..yrviapDlrGhGr
00474441   1/1  -------------------------pveegrfvtvdglrlhyreagsgppvvllHGlggglgssesw..r
00471941   1/1  -------efvtvdggdllllrlhyreagdgppvvllHGlggssesw........rplaeaLaerGyrvia
00445601   1/1  ------------------------gppvllvhGlggsssshwwrp...laealasagyrvvaldlpghgl
00509471   1/1  ----------------------------------------------------------------------
00501121   1/1  ----------------------erfvtvdglrlhyreagp.gppvvllHGlggssesw.rpla..eaLae
00459841   1/1  --------------maalvpfeertvtvdglrlhyreygppsgppvvllHGlggsseswr..plapaLae
00462211   1/1  ----------------l.ppgagsgppvvllHGlggsseswll...........................
00488251   1/1  ----------------------------------------------------------------------
00458861   1/1  --------------lllllrywrdifdwltlepllvpfeefvtvsdglrlhyreygppdgppvvlllHGl
00433261   1/1  ---------------------melislllgfgglqkvyslaflrllvslpsapdgldvrfllytpdnpei
00480751   1/1  -------------rlhyrpag.egkppvvllHGlggsseswrp..lapaLad..gyrviapDlrGhGrSd
00457361   1/1  ----------------------------------------------------------------------
00396021   1/1  ----------------------------------------------------------------------
00451861   1/1  ----------------------------------------------------------------------
00465731   1/1  -------------------------lelepllnpveertvtvgdGlrlhyreagpgppvvllHGlggsse
00460041   1/1  ----------------------Ppeterlvtvdglrlhyreagp.gppvvllHGlggssesw........
00510011   1/1  -------------------------dgppvvllHGlggssesw........rplapaLaerGyrviapDl
00474951   1/1  ----------------------------------------------------------------------
00425511   1/1  ----------------------------------------------------------------------
00499281   1/1  ----------------------------------------------------------------------
00457421   1/1  -------sefvtvdglrlhyreagpgppvvllHGlggssesw........rplaeaLaerGyrviapDlr
00399141   1/1  ----------------------------------------------------------------------
00466241   1/1  ------------mkllllllllllllllllllllalllllpylpseldvrfllytlenpevrfitvdglr
00457411   1/1  -------------------------prfvtvdglrlhyreagdgppvvllHGlggsseswrp........
00411281   1/1  ----------------------------------------------------------------------
00460121   1/1  -------------Kklllllllilllllplgtllfrlplllppppddldvrfllylnlnpeevtfvdvdg
00472201   1/1  -------------mkllllllllllllllllllllllllllpllppeldlrfllytlpleevrittedgl
00496301   1/1  ----------------------------------------------------------------------
00410811   1/1  -----------------------peegrfvtvdglrlhyrevgppdgkptvvllHGgpggssgswrp.li
00489351   1/1  ----------------------------------------------------------------------
00478791   1/1  -------------------ypgpgsgppvvlvHGlggssr......................swrpgldy
00480081   1/1  ---mklllllllllllllllasllqrpllllpssppeldvrlllytpeniesrdgdtlglrlyypesgdg
00372391   1/1  ------------------yrgdgegppvvlvHGlggsasswlldywrs...laeaLaeaGyrviavdlrg
00423391   1/1  ----------------------------------------------------------------------
00490941   1/1  ----------------------------------------------------------------------
00480031   1/1  ----------------------------------------------------------------------
00461261   1/1  --------elsllplialpagscpdvivifahGtges..............gllglagpllvdalaailp
00481261   1/1  ----------------------------------------------------------------------
00486751   1/1  ----------------------------------------------------------------------
00475921   1/1  ----------------------------------------------------------------------
00462021   1/1  ----------------------------------------------------------------------
00465021   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GSRWNATFMEHQSAWFDIASLADTNRRQDLQIQGLKESSQYVLGVIEREIELLGGRSDNIIFGGLSQGMA
00467931   1/1  dypghgespnpgaggrawfdilalsp...ggpedeagledaaedlaalidall.rlgidperivlvGfSm
00458241   1/1  ..yrggplgflgglqlfdllrghgespgpagllysledlaadllalldalael.gldpdriglvGhSmGG
00486331   1/1  vvapdyr.Ghgesggppadagsgnlglld......................ledlaaaldalldalgidp
00530451   1/1  gssgsa......swrplaralaarGyrvvapdyrggpehGfssgppgladggdll...............
00479401   1/1  pgveveevtiptpdGvrlhyrlylPdgggklPvvvllHGgggsseswr........plaraLaarGyrvv
00502451   1/1  evtiptpdGvrlpyrlylPpggggklPvvvllHGggg...........sseswrp.araLaarGyrvvap
00470031   1/1  HGgggssgsals....sldswrplaealaarGdlppyrvvap............................
00502261   1/1  gggsaesfrplaralaarGllnvvvlvapdyrghg...espgpag.........................
00476011   1/1  ylrlylP.ggplPvvvllHGGgflggsadswrp..laralaarlGyavvapdyrghgesggp........
00480531   1/1  gdprlplrlylPagpggklPvvvflHGGgflggsaesw........rplaralaarlGyavvapdyrghg
00518831   1/1  aglipgyivvapdlrgsggssapydp.........................adafldflaeellplldal
00489821   1/1  dgppvvllHGlggssesw.rpltgpgpglaeaLaarGyrViapDlrGhGrStgpvsldpgtgkgyyvdat
00466391   1/1  lplrlylPagpggklPvvvflHGGgflggsaeswrplaralaarl....Gyavvapdyrghgesgg....
00489451   1/1  gspswrplaralaarlGyavvapdyrGhGesggpptpagaaysgedl.......................
00498871   1/1  sdgppdd........................ysledlaedllaaldwlreniavfggllllldplrvvlv
00482071   1/1  vvvllHGgggssgsa.....gswrplaeaLaarGkpldtdrvyrVvapDyrGhGgSdgpapeapytllgw
00484601   1/1  gggplPvvvllHGggfvsgvaalgsseswrplggns....araLaarGyrVvapDyrGhGeSlgpegpls
00493831   1/1  glaealaer.....gyivvapdyr.ggge.gflwps...................ssgppgnfgledlld
00491281   1/1  alaarGyivvapdyrGfggsgpppad.........................gnyglldqlaaaaldwlra
00476271   1/1  h...........................................edlaadlaalldalg..pdrPvvlvG
00476001   1/1  gssgswslyrplaralaarliglgklpgyvvvapdyrGhgesggp.aagndgeddaedl...........
00466701   1/1  rnyg........glaealaerGyivvapdyRgggflrghgdsdgppgnfglldie...............
00477641   1/1  pkppvlllHGlggsseswldlgperslaeaLaer..G...yrvvapdlrGhGgsagpyslgpapgepgdy
00473881   1/1  apdlrGhGlSdgppsllp.............................ysledlaadlaalldal..gler
00496311   1/1  ........laeaLaarGyrVvapDlrGghGrsd.......................glppdysledlaeD
00458511   1/1  paLaaalgyrviapDlrGhGrSdgp.........................pdlgdysledladdlaalld
00490871   1/1  rGhGgsdgpppd.......................ysledlaedlaalldallel...gpekvvlvGhSm
00473171   1/1  d...................................eysledlaadlealldalgl..ekvvlvGhSmGG
00364431   1/1  rghglsggppdpalpldlgall.........allaaysldal...vedleaaldylraqp.vdagkvglv
00533481   1/1  GhGgSdgpp.............................ysledlaedlaalldal......giekvvlvG
00481941   1/1  sgplpvvllHGgggssgspswr..plaraLaa..gyrviapDlrGhGeSdgppd................
00502061   1/1  aLadrGyrviapDlrGhGrSdgp.........................pdfpdysledladdlaalldal
00472001   1/1  vlllHGlggss............................................gswldlgperglaea
00476831   1/1  plf...rslaraLaerGyrvvapDyrGhGgSg......................gpp...ysgedladDl
00395261   1/1  ---------------------------------------laaldyllallearlgvDpdriglvGhSmGG
00411931   1/1  -----------------------------------------liaaldylralggvdpdriallGhSyGGy
00460771   1/1  .gyrviapDlrGhGrSdgppsl..............................eysledlvddlaadleal
00470341   1/1  lrlhyylpg.ksgpvvvllHGgggssespywrp.laeaLakrG.dyrvvapDyr..GrSdgpapdd....
00490371   1/1  paLaeagyrviapDlrGhGrSdgp.........................pdlgdysledlaadlaallda
00464101   1/1  GhGrSdgppspd......................ysledladdlaalldal.....gidepvvlvGhSmG
00489651   1/1  Sdgppgpdysledladd..............................laalldalgid.ekvvlvGhSmG
00474441   1/1  plapaLae..gyrviapDlrGhGlSdgppg..........................pdysledladdlla
00471941   1/1  pDlrGhGrSdg.......................ppgdysledladdlaalldal......glepvvlvG
00445601   1/1  s......................................slddwvedllalldalg...epvvlvGhSlG
00509471   1/1  ---------------------------------------dDlvaaldwlleqggvDpdriaifGhSyGGy
00501121   1/1  rGyrviapDlrGhGrSdgppsd...........................ysledladdlaalldal....
00459841   1/1  ..gyrviapDlrGhGrSdgpp...........................pdysledladdlaalldal...
00462211   1/1  ...........lgywrplaeaLaerGyrviapDlrGhGgSdgpp...ysledlaedlaalldal......
00488251   1/1  ---------------------------------------------------------drvaiaGhSmGGy
00458861   1/1  ggssesw........rplaeaLaarGyrviapDlrGhGrSdgppspa.....................dy
00433261   1/1  gqllllldplllyrpgfngdrpvvvllHGlggsags.swwlplaralaarlgynvvavDyrghgrspypa
00480751   1/1  ppad............................ysledladdllalld..........epvvlvGhSmGGl
00457361   1/1  ---------------------------------------------------------ekvvlvGhSmGGl
00396021   1/1  -------------------------------------------------iaafggd..rvvlaGdSaGGn
00451861   1/1  -----------------------------------------alrwvreniaafGgDpdritlfGdSaGGa
00465731   1/1  sw........rplaeaLaeaGyrviapDlrGhGrSdgppspyp.....................ysledl
00460041   1/1  rplaeaLaarGyrviapDlrGhGrSdgppsd.......................ysledladdlaallda
00510011   1/1  rGhGrSdgppspl..........................ysledladdlaalldalgid.ekvvlvGhSm
00474951   1/1  ---------------------------------------------laalldalgidg.pvvlvGhSmGGl
00425511   1/1  ---------------------------------------------------------ervvlvGhSmGGa
00499281   1/1  -----------------------------------------alrwvreniaafggDpdrvtlaGhSaGGa
00457421   1/1  GhGlSdgppsd.......................ysledladdlaalldal......glepvvlvGhSmG
00399141   1/1  -----------------------------------------alrwvreniaafggDpdrvtlfGdSaGGa
00466241   1/1  lyyppsgdgkkpvvvllHGgggsaespywrp........laeaLakrGgyrvvapDyrGhGes.......
00457411   1/1  laeaLaerGyrviapDlrGhGrSdgp.......................pgdysledladdlaalldal.
00411281   1/1  ---------------------------------------------vreniaafGgDpdrvtlfGdSaGGa
00460121   1/1  lrlyypppgdgkkpvvvllHGgggssgspyw.rplaraLaerG.gyrvvapDyrGhGesdgppady....
00472201   1/1  rlhyrppgdgkgpvvvllHGgggsaespyw........rplaraLaerGgyrvvapDyrGhGes......
00496301   1/1  -------------------------------------------------iaafGgDpdritlaGdSaGGa
00410811   1/1  paLae...gyrviapDlrGhGrSdpppge..............................gytlddladdl
00489351   1/1  -----------------------------------------alrwvreniaafggDpdritlaGhSaGGa
00478791   1/1  wlgpkdslaeaLakaGyrVialDlr................p.sdysledlaedlaylkgGtvdywdfsf
00480081   1/1  pkpvvvllHGgggsaespyw........rplaraLadrGdyrvvapDyrGhGes................
00372391   1/1  hGrs.........................P.......ysledlaadlealldalgi..ekvvlvGHSmGG
00423391   1/1  ---------------------------------------------leallealg...ekvhlvGhSmGGl
00490941   1/1  ---------------------------------------------------------epvvlvGhSmGGl
00480031   1/1  ----------------------------------------------------------------------
00461261   1/1  gagvavvgvdlryfarvfggv.............afldslaegaddlaalldallakcp..dtkivlgGy
00481261   1/1  ---------------------------------------laalrwvreniaafGgDpdritlfGhSaGGa
00486751   1/1  -----------------------------------------------eniaafggDpdritlfGhSaGGa
00475921   1/1  --------------------------------------------lideaialldalgleg.kvilvGHSm
00462021   1/1  ---------------------------------------------vreniaafggDpdrvtlaGdSAGGa
00465021   1/1  ---------------------------------------laalrwvreniaafggDpdritlaGhSaGGa


                         +         -         -         -         -         *         -:210
query           TALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASELGTSMCLIMPAFLLGTTGCPPFD
00467931   1/1  GGalalllalrlpd....rvaglvllsgalplaallp.................................
00458241   1/1  alalalaslrypd....rfkalvllspaldlldlllsllllll...........................
00486331   1/1  ervvlvGhSmGGalalalalrypdr....vkalvllspaldl.talala..............lllleag
00530451   1/1  .......aedlaaaldwllen.gidp.rvvlvGhSmGGalalalalrypd....rvkalvllspaldlaa
00479401   1/1  apdyrGhG.......................esggppadysledlgfyddeqakpyglhfpmvadDlaaa
00502451   1/1  DyrGhGrSsppaslngalgfasggdfpaatlgdlggvenallrllaeDlaaaldwlrenfgidpervvlv
00470031   1/1  ...pgpygledlaaaldwlldellginiaafgtlaerlllklgdpervdrvlvGhSmGGalalalalry.
00502261   1/1  ..ledlaaaldwlldn......ldpdrivlvGhSaGGalalalalrypdrglplllllldllsllsrvka
00476011   1/1  .......................aaledlaaaldwllenldalgidpdrvvlvGhSaGGalalalalryp
00480531   1/1  esgg...........................paaledlaaaldwllenldalgidpdrvvlvGhSaGGal
00518831   1/1  yp.vgadpdrvvlaGhSmGGllAlylalryPe....rfagvvalsgslwpsdgplgdpealrey......
00489821   1/1  lplllllglglewsllrfdgppgdggaglv.................ysledlaedlaalltdalrartg
00466391   1/1  ...........................pagledlaaaldwllenlaalgidpdrivlvGhSaGGalalal
00489451   1/1  ...aeDlaaaldwlrenfgidpdrvvlvGhSmGGalalalalrypdr....vkalvllspaldllallls
00498871   1/1  GhSmGGalalalalrypd.....vkalvllspaldllalllalllllll.....................
00482071   1/1  gf..................sledlaeDlaaaldwlrenfgidpervvlvGhSmGGalalalaary....
00484601   1/1  lgddflggf...................gedaadDlaaaldwlrenlgidpervvlvGhSmGGalalala
00493831   1/1  alaedlidlleaklgidpervalvGhSmGGllalalalrypdl....fkgvillspaldlsdlals...e
00491281   1/1  n...lgidpgrvvlvGhSlGGalalllalryPdl....vaglvllsgplpgsaaala.............
00476271   1/1  hSmGGllalalaarleeype....rvaglvllspplplsalalal.............rlppgllaalle
00476001   1/1  ...............lalldali.rfggdpdrvalvGhSmGGalalalalrypd....rvkalvllspal
00466701   1/1  .....daladelidalidalgidpervalvGhSmGGllalalalryPdl....fkalvllspaldlladl
00477641   1/1  .sledla................vddlaaaldylrerlgi..ekvvlvGhSmGGllalaaaarlpelge.
00473881   1/1  vvlvGhSmGGllalllaarype....rvkglvllspaldllal...........................
00496311   1/1  laalldalreq...gpervvlvGhSmGGllalalaaryp......vkglvllsppldlsalalallrlll
00458511   1/1  al......giekvvlvGhSmGGllalalaaryPer....vkglvllspplplsaladallllarqallpd
00490871   1/1  GGllalalaaryp......vkglvllspaldlsalpllleallkrlldrllgdelldlllladplllarl
00473171   1/1  lvalllaarlpal..drvaglvllsppl......................................llll
00364431   1/1  GhSlGGalallla..apd....rvkalvllagaldl..................................
00533481   1/1  hSmGGlvalelaarype....rvkglvllappldgspladallellrkallalllkllgllpe..lllll
00481941   1/1  ............rlgpysledlaadllallrdalgid..pvvlvGhSmGGllalalaarlaarype....
00502061   1/1  ......giekvvlvGhSmGGlialalaaryPe....rvkglvllapapplsaladallrllaalllalpa
00472001   1/1  LaerGyrVvapDlrGhGrStgpgflddgpgdpgdysledlaeaDlaaaidylldalgie..kvvlvGhSm
00476831   1/1  aaaldalrenlgid.ervvlvGhSmGGalalalaaryPd....rvkglvllspaldl.............
00395261   1/1  alalllaardpd.....vkavvllapvldl........................................
00411931   1/1  lalalaarypdl....fkaavalspvldl...........................llydtayterylgl
00460771   1/1  ldalgid..kvvlvGhSmGGlialalaaryper....vkglvllspalplppllplllarllalllalll
00470341   1/1  .....................eysledlaedlaalldallenfgidperivlvGhSmGGllalalaaryp
00490371   1/1  l......giekvvlvGhSmGGlialalaaryPer....vkglvllapalplseladwllrllakallepl
00464101   1/1  Glvalalaarype....rvkglvllspplplllaslaalllallaallsllllllllallllllgll...
00489651   1/1  Glialalaaryper....vkglvllapppplsalalalllllllelllalllalllallllllgadpsll
00474441   1/1  lldal......giekvvlvGhSmGGlialalaaryper....vkglvllapalplsa........llpll
00471941   1/1  hSmGAGlvalalaaryp....ervkglvllsppapllllaellplgllaallarllalllaglpelllrl
00445601   1/1  glvalrlaarlpela..rvaglvllapalplleglpellellkrldllel....................
00509471   1/1  lalalalalldrypdrfkaavalapvtdllly........................dsgylerylglpee
00501121   1/1  ..glepvvlvGhSmGGlvalalaarygpervkglvllspplplllladallagllrallaallalllapl
00459841   1/1  ...giepvvlvGhSmGGlvalalaaryPe....rvkglvllspplplsaladaalllllllaallarlle
00462211   1/1  giekvvlvGhSmGGlvalalaarype....rvkglvllappldgsaladallellaaallallatllgal
00488251   1/1  gAlalalrllypd....rfkavvalspvvnp.....................sllpwgqkafegylgddk
00458861   1/1  sledladdlaalldal......giepvvlvGhSmGGllalalaaryPer....vkglvllspplplsala
00433261   1/1  aaydle...........................dlaadlaalldalianygidpervhlvGhSlGghvAl
00480751   1/1  ialalaaryper....vkglvllapapplldlaellarllkalaallalllllleallkrlllllllgll
00457361   1/1  ialalaarylper....vkglvllapplplllglppllglllarllalllallgallaellrrlllslll
00396021   1/1  lalalalrlrdrglpp....rvaglvlispvldlpaalpselenlarrlaalaggplltlealarllrly
00451861   1/1  laallalsprsrglFhrailqSgsalspwalleealelakrlakllgcsgsdsaellecLrkvpaeeLld
00465731   1/1  addlaalldal......glepvvlvGhSmGGllalalaaryPer....vkglvllspplplsapldalle
00460041   1/1  l......giepvvlvGhSmGGlvalalaaryPel...rvkglvllsppadlsaladallpllllallldl
00510011   1/1  GGlialalaaryper....vkglvllapppplsaladallrllllalllllllllllyllllllllggla
00474951   1/1  lalalaaryper....vkglvllspplplsala...plllallllllllellarllallgadpalldpel
00425511   1/1  ialllaarhpe....rvaglvllapaaplealapallrllalllarlllptleallallallaallpllp
00499281   1/1  lalalalrlsplgpplfagailispvldltwltp.salenadalapllgcdslaelleclrgvspedlld
00457421   1/1  GlvalaYlaaryper....vkglvllsppapladladplaglllarllaallalllallpelllrlllel
00399141   1/1  laallalsprdpglFkaailqsgvallpwallelalrlarrlakllgcsgedsaelleclrsvpaeellk
00466241   1/1  ................pgpaalydledaaedlaalidallekygidperivlvGhSmGGalalalaaryp
00457411   1/1  .....glepvvlvGhSmGGllvalalaaryper....vkglvllapplplsalalallllllaallalll
00411281   1/1  laallalsprdpglfkrailqsgsallpwallteealelakalakllgcsgsddaellecLrsvpaeell
00460121   1/1  .......................sledlaedlaalldallerygi-------------------------
00472201   1/1  .................dgppglydledaaedlaalidalle----------------------------
00496301   1/1  lalalalrlrdrgsplspplfagaillspvldlpw...............llpseeanaladalakllgc
00410811   1/1  ealldallgle..kvvlvGhSmGGalalayAaryPd....rvkglvllgpagllplellalllllllllp
00489351   1/1  lalalalsprd..pglfaaailispvldltaltp..serenaalaallgc.....laelleclraasade
00478791   1/1  deiglydlpaaiealldalglel.kvvlvGHSmGGlvalaaaarlgpelveklivvdiapvlydgrlawy
00480081   1/1  .......dgpaglydledaaedlaalidallekygidperiv----------------------------
00372391   1/1  lvalyaaarrPd....rvaslvllgpphlgspladllprllpllllealllalagllgallslllgpell
00423391   1/1  varalaarlper...kvkslvllapPhlgspladllpllllpdlllklllllllteflqkl......vpa
00490941   1/1  valllaarlglape....rvaglvllspapplaalaalllrlllllplleallalllaallrrllallfl
00480031   1/1  ----------------------------------------------------------------------
00461261   1/1  SqGaavaalaalelpedladrvagvvlfGsPr......................................
00481261   1/1  lalalalsprd..rglfagailispvldlpwalpsyeeaaegplllaellgcflslyl......gddadl
00486751   1/1  lalalalsprd..pglfagailispvldlplalpsyeeaaelalllaealgcflslylelleclrdpsas
00475921   1/1  GGlvalyaaarlpeegpeeiealgsggpklspllksypdrvkglvllapPhlGspladllrsllplllll
00462021   1/1  lalalalsprdlalalspplfagaillspvldltwaltpseaenaadplltalgcdslaelleclrgvsa
00465021   1/1  lalalalsprdpg....lfagailispvldlplllpsleeaaegalllaealgcflalylelleclrdpp


                         -         -         -         +         -         -         -:280
query           SKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQACQLLKEMGMDVKFYEYSGAENEGHWIKEPDGFDQIAA
00467931   1/1  ....dllellaklkvPvllihGeaDpvvppeaaralaealpaagvskdvelvvypga...gHgfp.leap
00458241   1/1  ............kvPvliihGekDplvppeeaealaealpaagvdvelvvyp.a...gHgf.lleapeev
00486331   1/1  lgllpellealraydplellakikavPvliihGedDplvppeeaealaealpaagvpvelvvip...gag
00530451   1/1  llpsllelllllllllllll............laallaldplellaki.kvPvliihGedDplvppedae
00479401   1/1  ldwlrenfgidpervvlvGhSmGGalalala.rypdr....vkglvllspaldlaalllpeallallral
00502451   1/1  GhSmGGalalalaarypd.....vkalvllspaldls...........................rlllgl
00470031   1/1  ...Pdrvkalvllspald............................glgllledlaallaasplellaki
00502261   1/1  lvlispvldllalllslll.................lrkflleylggdlaedlelllaaspllaedlkki
00476011   1/1  drglprvaalvllspaldll........alapslaellggdpllppellerlrallledlaalllplasp
00480531   1/1  alalalrypdrglplvaalvllspvldl.......................eellpsyle.llggppldp
00518831   1/1  ......................dplellaklkvpvllihGteDglvppe.aralaealpaagipvelvel
00489821   1/1  vllllanaeslgiglervvlvGhSmGGavalllaaryPe....rvkglvllspald..............
00466391   1/1  alrypdrglprvaalvllspvldlpa...................sldlpslreladgpllppallerll
00489451   1/1  llllll......lleallgllpellealraysplellkllllakikvPpvliihGedDplvppeeaeala
00498871   1/1  lalllaydplellkkiakvPvliihGedDplvppeeaealaealkaagpnvelvvillpga...gHgf.l
00482071   1/1  Pdrvkglvllspald............................llpldpallerlllallgdllaallal
00484601   1/1  arlyPd.....vkglvllspaldllpadlpsleralldallddl.......lpllllrllladaallppe
00493831   1/1  llelllkelgekgvprllgnvyleylraydpl....dllkklakikppvliihGekDlipllggdllgef
00491281   1/1  .....elpeallallggldlelllgpvllgdlllldpldlledlkaikvpvliihGedDpvvppenllei
00476271   1/1  llraldllplelllaglllklllldllywnldalaki.kvPvlvihgedDplvp.eaaealaealpg...
00476001   1/1  dllalalallllal...................................lakikvPvliiAhGeaDplvp
00466701   1/1  lpflerllkallgekglpaylgpivpeallaysplellkklian.....kppvllihGtnelgdllllll
00477641   1/1  rvkglvllappldlsplaepllrlllalllfldgllgllgllpgellagalrllrpddlsleelvakllr
00473881   1/1  .............lealaki.kvPvlvihgedDplvppel......alaealpnaelvvlpgagHfllle
00496311   1/1  lll.....................lppefledllalfdeelrdlllgllrallalaeadpledlaki.kv
00458511   1/1  llaallallpagllaalleallrllallaflsdealleallrllalylalltdpeallallealraglfl
00490871   1/1  lldlladllalledllealakikvPvliihGedDplvppedaeelaealp..gadvelvvipgagHflfl
00473171   1/1  lldllellakikvPvlvihgedDpvvppesa.........llpnaelvvlpgagHlllle.npeevelil
00364431   1/1  .......dpledlaki.kvPvliihGedDplvppelaealaealka.gpdvellvypgagHgffleeagl
00533481   1/1  allrrldllealkki.kvlttegallfnakyPnggleapgsaeeglplellggngvlyyswsgtslepll
00481941   1/1  rvkglvllsppldlse....llesllrlllarlllddlleallgglladpellrdlsplpllakikvPvl
00502061   1/1  llfglgallelllaldplallralldllygddalllekfgrwlllenafsvelypaplsdelleallapl
00472001   1/1  GGllalalaaryPelgd.rvkglvllsppldlsdlaepllallaalllllaallgllgalllallarall
00476831   1/1  llddlllpggapllplllalllgdlaalllallrllleallrllaallllsplladlsylrllalrllaa
00395261   1/1  .....edlakikvPtlvihgeaDpvvppeqaealaealpaagvpaelvvypgagHgflleepeevaaail
00411931   1/1  pllpedpealkayspleladkikpppvllihGtaDdvvppeqsealadalkeagvpvelllyp...gagH
00460771   1/1  eallelllrlllspdpltldpelleallrlllapgalaalaallrlllsaldly......adllealkki
00470341   1/1  d....rvkglvllspalplpedadllk-------------------------------------------
00490371   1/1  lllllalllalllallleallellladlllsddlaalllllllllsdlrlspeallalldalsalslara
00464101   1/1  pallspeellayllallrpgflaaalallrglldalallaradllealakikvPvlvihGedDplvppea
00489651   1/1  deeelrallaallrpgdaeallallralrlalallaradllealkkikvPvlvihGedDplvppeaaeel
00474441   1/1  lalllallpeallarllrllgadplllsdelleaylrpllrpdflrallalllalasaldlydadlleal
00471941   1/1  lallflpplllleelldellaalllpflraglrallralrallldlldllerlkaidvPvlvihGedDpl
00445601   1/1  ........lkklpvpvlvihgedDpvvpfelaerlaeal.....gaelvvipgggHllllegpeevaell
00509471   1/1  npeaydaysplehadklkltplllihGtaDdvvppqqsealaaalkaagvpvellvypg...egHgfskp
00501121   1/1  llalrrllgllpallslpellealleylrddllradlrallallralrdadllealakikvPvlvihGed
00459841   1/1  llgalspeellellarllladlldpelleaylrllladgalraalalyrlllealdlsdlalaradllea
00462211   1/1  la...llllllllllldpelleallelllrpgplraalllyralddllaeadllealkkipkkvPvliih
00488251   1/1  eaweaydplellkklkglplppvllihGtaDplvppelspealyealkaagvppnvelvvipgagHsfff
00458861   1/1  pallrllaalllalllalllallrelllrlllllaallaglspelleallalllapgalradlallrall
00433261   1/1  laalrl....p.rvaglvlldpagplfeltdpl-------------------------------------
00480751   1/1  lddelaelllallralgtadllallellralrradllealkki.kvPvlvihGedDplvppeaaeelael
00457361   1/1  plllsdelleelllallrdlllradlegllallralrradllealkkikvPvliihGedDpvvppealae
00396021   1/1  lpd.gadlddplaspllalddllrglp.PtlivhgeaDplvp..ealalaaalraagvpvelvvypgagH
00451861   1/1  aqlllllllppkikglvlfyPvvdgdflpddplellasgkkvplliGvtsdEgllflllllpllllllll
00465731   1/1  alakllaslpdllfllggllelllplspaallrlladlplglaallaekfgrwlgfdveslldnqgsall
00460041   1/1  llallaallaallerllallgldpllldeelleallalllapggldallaylrallalaldllealaki.
00510011   1/1  llltdpellalllalllagfarallallaglldalallaeadllealkkikvPvlvihGedDplvppeaa
00474951   1/1  leallalllrpgalralaalyralldaleradllealaki.kvPvlvihGedDplvppedaealaeal..
00425511   1/1  eallrallrrllaldflgllfdpallaallealarpgaraslealrallralaladl....raalari.t
00499281   1/1  plaGsplladd.lsglpdpilvgvadgdvlpddplalaealkaagvpvllg-------------------
00457421   1/1  llpllladaelleallrylldlllradlrallallralaradllealakikvPvlvihGedDplvppeaa
00399141   1/1  aqlkllllglllllpkiaglvlfypvvdgdflpddplellasgkfakvplliGvtsdEgllfllllllel
00466241   1/1  d....rvkglvllspaldlpe.......------------------------------------------
00457411   1/1  alllallallaeallaalfgpllrddllldellellrdlllradlaallallralarldllealakikvP
00411281   1/1  aaqlkllllglllllpriagqvlfypvvdgdflpdsplellasgkfakvplliGvtsdEggpf...ltre
00460121   1/1  ----------------------------------------------------------------------
00472201   1/1  ----------------------------------------------------------------------
00496301   1/1  dglldslelleclrllsaedlldplasplladdlsllppvlivvgeaDgvvlpddplalaealkaagvpv
00410811   1/1  allaallaallallladllaalllrllfpdallrdpelvaelledllrasglaaalalllllyllllaal
00489351   1/1  llpaaspl....PvllslelllliihgeaDgvvlpddplalaealkaagvpvllgvyp...geghgflll
00478791   1/1  pervkglvllapPhlGspladlllallpllallllaallsfllrllallsflpdldldllgllrllpe--
00480081   1/1  ----------------------------------------------------------------------
00372391   1/1  lqilldalsdlttellaaflellpgsgflaallhgaqlvpgvrygsylrllllnleldpladlrkikvPv
00423391   1/1  gysrdpllvdlylessifladlnnerallanleykenlsrlvpvllihgenDgvvppessealaerlpnt
00490941   1/1  adldpellaalladllrlgaaalaallraldllaradllaalakikvPvlvihGedDplvppe......e
00480031   1/1  ---------ikvPvLiihGlaDtlvppeqalrlyealpe.gnp.kllilp...gagHgfpnpenpeefle
00461261   1/1  ....lplglpalpdllkdktlilcgegDp-----------------------------------------
00481261   1/1  ldclrslpaeellkaspplagdlagppptfvpvadgdvlpddplelaealk-------------------
00486751   1/1  pllaallglaglllppplifvgvadgdvlpddplelaealkaagvpvllgv-------------------
00475921   1/1  pllaellrsllglllllllldfdlallpllllslllfldllrdfratdlleeddiglkdlsle-------
00462021   1/1  edll.......dplaspllagdlsglpptlipvgdgd..vlpddplalaealkaagvpvllgvte-----
00465021   1/1  aspllaadllll.dllsglppifipvadgdvlpddplelaealkaagvpvllgvte...g----------


                         -         *         -         -         -         -         +:350
query           FLESKTS---------------------------------------------------------------
00467931   1/1  eevl------------------------------------------------------------------
00458241   1/1  lefllef---------------------------------------------------------------
00486331   1/1  Hgflfleap-------------------------------------------------------------
00530451   1/1  alaealpa--------------------------------------------------------------
00479401   1/1  llde------------------------------------------------------------------
00502451   1/1  lpa-------------------------------------------------------------------
00470031   1/1  kvP-------------------------------------------------------------------
00502261   1/1  kvPv------------------------------------------------------------------
00476011   1/1  lea-------------------------------------------------------------------
00480531   1/1  elle------------------------------------------------------------------
00518831   1/1  pg.-------------------------------------------------------------------
00489821   1/1  ....------------------------------------------------------------------
00466391   1/1  gallgdp---------------------------------------------------------------
00489451   1/1  ealp------------------------------------------------------------------
00498871   1/1  leape-----------------------------------------------------------------
00482071   1/1  lal-------------------------------------------------------------------
00484601   1/1  lldal-----------------------------------------------------------------
00493831   1/1  levvp-----------------------------------------------------------------
00491281   1/1  lk--------------------------------------------------------------------
00476271   1/1  pvelvv----------------------------------------------------------------
00476001   1/1  ..eaealae-------------------------------------------------------------
00466701   1/1  palaDel---------------------------------------------------------------
00477641   1/1  lllggda---------------------------------------------------------------
00473881   1/1  apeev-----------------------------------------------------------------
00496311   1/1  Pvlii-----------------------------------------------------------------
00458511   1/1  rl--------------------------------------------------------------------
00490871   1/1  eapr------------------------------------------------------------------
00473171   1/1  dflakll---------------------------------------------------------------
00364431   1/1  ydaa------------------------------------------------------------------
00533481   1/1  Pvll------------------------------------------------------------------
00481941   1/1  iihG------------------------------------------------------------------
00502061   1/1  lrpgfral--------------------------------------------------------------
00472001   1/1  alll------------------------------------------------------------------
00476831   1/1  fdnf------------------------------------------------------------------
00395261   1/1  dfld------------------------------------------------------------------
00411931   1/1  gflk------------------------------------------------------------------
00460771   1/1  .kvP------------------------------------------------------------------
00470341   1/1  ----------------------------------------------------------------------
00490371   1/1  pl--------------------------------------------------------------------
00464101   1/1  aeel------------------------------------------------------------------
00489651   1/1  aellp.----------------------------------------------------------------
00474441   1/1  kki-------------------------------------------------------------------
00471941   1/1  vppe------------------------------------------------------------------
00445601   1/1  ldf-------------------------------------------------------------------
00509471   1/1  enrl------------------------------------------------------------------
00501121   1/1  Dplv------------------------------------------------------------------
00459841   1/1  lakikvPv--------------------------------------------------------------
00462211   1/1  Geddp-----------------------------------------------------------------
00488251   1/1  wep.------------------------------------------------------------------
00458861   1/1  gfld------------------------------------------------------------------
00433261   1/1  ----------------------------------------------------------------------
00480751   1/1  l....pna--------------------------------------------------------------
00457361   1/1  elae------------------------------------------------------------------
00396021   1/1  gfl-------------------------------------------------------------------
00451861   1/1  ldll------------------------------------------------------------------
00465731   1/1  ddell-----------------------------------------------------------------
00460041   1/1  kvPv------------------------------------------------------------------
00510011   1/1  eela------------------------------------------------------------------
00474951   1/1  ..pna-----------------------------------------------------------------
00425511   1/1  vPt-------------------------------------------------------------------
00499281   1/1  ----------------------------------------------------------------------
00457421   1/1  eala------------------------------------------------------------------
00399141   1/1  tpse------------------------------------------------------------------
00466241   1/1  ----------------------------------------------------------------------
00457411   1/1  vlvi------------------------------------------------------------------
00411281   1/1  llel------------------------------------------------------------------
00460121   1/1  ----------------------------------------------------------------------
00472201   1/1  ----------------------------------------------------------------------
00496301   1/1  llgvtp.---------------------------------------------------------------
00410811   1/1  ar--------------------------------------------------------------------
00489351   1/1  aplp------------------------------------------------------------------
00478791   1/1  ----------------------------------------------------------------------
00480081   1/1  ----------------------------------------------------------------------
00372391   1/1  lli-------------------------------------------------------------------
00423391   1/1  vll-------------------------------------------------------------------
00490941   1/1  rl..------------------------------------------------------------------
00480031   1/1  ail-------------------------------------------------------------------
00461261   1/1  ----------------------------------------------------------------------
00481261   1/1  ----------------------------------------------------------------------
00486751   1/1  ----------------------------------------------------------------------
00475921   1/1  ----------------------------------------------------------------------
00462021   1/1  ----------------------------------------------------------------------
00465021   1/1  ----------------------------------------------------------------------