[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_02920


[Show Plain Result]

## Summary of Sequence Search
   1::1547
1239::1391 1.7e-10 18.8% 0050517 00505171 1/1   main-like                               
1240::1381 5.7e-09 18.4% 0050056 00500561 1/1   main-like                               
1245::1364 5.7e-08 20.4% 0050772 00507721 1/1   main-like                               
1244::1363 2.8e-06 22.3% 0040866 00408661 1/1   main-like                               
1253::1380 2.2e-05 25.5% 0052196 00521961 1/1   main-like                               
1259::1380   4e-05 20.4% 0050571 00505711 1/1   main-like                               
1248::1372 0.00034 21.6% 0047098 00470981 1/1   main-like                               
1243::1363 0.00048 19.1% 0051136 00511361 1/1   main-like                               
 204::306  0.00065 23.3% 0053562 00535622 2/4   n rod fragments                         
  57::106     0.57 32.0% 0053562 00535621 1/4   n rod fragments                         
 402::454       68 22.6% 0053562 00535624 4/4   n rod fragments                         
 311::366    1e+02 21.4% 0053562 00535623 3/4   n rod fragments                         
   1::1547


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MADSLPMYAAGAVGDNGVDLDDPFISSTPAGNHTQRELHRYSSFDAQLFTLNTSSPAQAKRALEAHLAET
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  --------------------------------------------------------sklkakleqqleel
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ERRLEETSNLGTALIEQQRELMDKLKEVEQQHTDGEIGPDLRRKLNDLEREYNEIGRETARVALGPKVRL
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  eerleeEekaraelekakrklegelddlkeqleeee----------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TGQEDGLATPSLDSRHHASPSVFSSQATNSPSKVTVPSRKQRNQPSSRVHDIEFATEISTSLLAQVRQLQ
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ---------------------------------------------------------------eqlkele
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ALLAEREEAIKALTLEKSHLELEAEGFTQRLRALDESEQRYKDENWSLETQTHDLLAAAKEASDRESRLT
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ekleelerqlakllkekkrlqeelqelteqleeaeeklsqlsklkakleqqleeleerleeEekaraele
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SNLNALTVEKNNIQRELDELKQANGRLVEENMATQKALDSELHILRRNITLGESERNALQQKVDELAGQN
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  kakrklegelddlkeqleeeeaalqk--------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ------------------------------Pllnverlekelaklekelkkleeqlkeleekleelerql


                         -         -         -         -         *         -         -:420
query           QELAKAVAAKLRQHEADSAKDPNPEDNRKASDDLTPENSPPPSPNKPTPRHGLLESETLKSSLHHAHRMI
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ---------------------------------------------------Pllnverlekelaklekel
00535623   3/4  akllkekkrlqeelqe------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           QTLKGTIHREKTEKIELKRMLQDARDELEQRRAEPVRPISSHNRRQKPKGDNFKKPARPEMLGAGRKGIT
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  kkleeqlkeleekleelerqlakllkekkrlqee------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           QIEVAEPEWEDEGEPSPTRVARPNKRAVSYGNSGIESSTTSDAYQTANETEAFETANEREVTTESEAFQT
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           GTENFIDESSDDLTETESRTMHTGTIRPRRSGQLNSTRPMSFASTASTSGDEDEYIEVRTPVQHQPPRYR
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           IKMSRGRRGRVSQESHIRQGSVPLSPRDSPASLNSPPQSPRQREISGGQSLFAELSGLAGAGSDSEFGAP
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           LRSSTMSEMSTPSRRQSFATLADSSRPVTAREIVMVDSCTMTEPLPPAVPAQFEIVSPPESTSDYKDAET
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           STAPREGVDAFTTFERIVVIDSATQCMPIETPLLAKSEPAVTIDIAPEIPDTDANHESLHATIETLPSPV
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           MLPMEPTILDISPIYSEQTAPISPMPIDLQSRRPSVRMDMSVIAFEDSRPSLPAVTPSKSSLDLAMSSIQ
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           STSTNPLAVPVSLPESKRAQVLEFSTIFEVGTSPKEAIFPTVPPMTLEVSNIQCVESLPVKPVPTILSVE
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           PPTDTLKLNGIEAQPCPPQVTDRATQSQISTMDRGISTSPLPKIETESQGSQTALTEVLETGERSSQVQI
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           STAEISSQTILTGFQIDKLLMERQASRPVTAIESSQAQAAIISTQSSPLTTPKAKQLSSAQTGLLHPNNA
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           TRRPGSSGSQRLGNSLSVPPLPVDHKQTIAAASQRLSSEASPSVMGPPIAPASSYRSSSQIRPRTPSEQP
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:1260
query           SRNSARNQSTPQTKFRRTSTSMASRRSSISSFASELDERFNIAKATYPFESGADPRMIQAITQTMIGEFL
00505171   1/1  ------------------------------------------------GssplsglsdlllpgsevikeG
00500561   1/1  -------------------------------------------------glsllelllelgsdvikeGyL
00507721   1/1  ------------------------------------------------------SldllellsevlkeGy
00408661   1/1  -----------------------------------------------------gllveqllevlkeGtll
00521961   1/1  --------------------------------------------------------------plkeG.yL
00505711   1/1  --------------------------------------------------------------------yL
00470981   1/1  ---------------------------------------------------------SlpgrdvikeG.y
00511361   1/1  ----------------------------------------------------gldllvllssevlkeGyL
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:1330
query           WKYTRKLGRSDMSNTRHQRYFWVNPYTRTLYWGPHDPQVLAKSQQRSKSVAIEAVRVVNDDNPYPPGLHR
00505171   1/1  yLlkkglgkgkkgllksWkkrwfvLdklsgkggvLyyykdekd....dkkpkgsipLsgctvveadd..e
00500561   1/1  lkkrggllks......wkkrwfvLreeggvLyyykdekdklglklkpkgsipLsgctvvravedkkglkr
00507721   1/1  Llkkggk......lkgwkkrwfvLrgdglvLyyykldekdkkpkgsidLsgctvelvddlskllkaelld
00408661   1/1  kkvg.......srkkwkkrwfvLdedtstLyyys.sekldkkpkgviplssikevrlgkdsellrrlvdd
00521961   1/1  lkkgkk.....llkswkkrwfvLk..ggvLyyykdekdk.....kplgsipLsgctvvevvd.......k
00505711   1/1  lkkgkk.....llkswkkrwfvLldlkggvLyylkykde...kd.kpkgsipLsgctvvevdklldskkk
00470981   1/1  Llkkggk......lkswkkrwfvLrgd.gvLyyyksekdkk.....pkgsidlsgc.sveevlplkdssk
00511361   1/1  lkrggk......lkgwkkrwfvLrddglvLyyyksekd.....kkpkgsipLsgctvvevldlklsdksk
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:1400
query           KSLEIITPGRTLKFTAATSQRHETWFNALSYLLLRTADDETEEQDVVWEAGSDYNATNGRNSRQAESRRS
00505171   1/1  k..rkfcFeivtpdgrtyllqaeseeereeWvealrkaialalelesleepslsllssssl---------
00500561   1/1  pfvFeivtpdrtyllqaeseeereeWvealqkaialllap...........-------------------
00507721   1/1  kkfvFeivtpdrttyllqaeseeereeWvealql------------------------------------
00408661   1/1  lkedlcFsIiygdrlktldLvApseeeaeeWvd-------------------------------------
00521961   1/1  fvfeivtpgrtyylqaeseeereeWvealqkaillllllllle......a--------------------
00505711   1/1  kfvFeivtpdrtyylqaeseeereeWvealqkaialllslllplesllls--------------------
00470981   1/1  rpfvfeivtlsltggrtyllqaeseeereeWvealrlaiall----------------------------
00511361   1/1  rknvfeivtpdgrtyylqaeseeereeWiealq-------------------------------------
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:1470
query           ISSHNSRAARTISKQFVETVPTLRRPVTPNQPSPSPSSRPGSSLRPDQTRPGSVTRISNVFRSSGIKSTF
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:1540
query           SSRRSRYGNASGSIDSTSAASNDSAEELRRVIERQDREADRLENVRACCDGKHDVSALSRTSRYSARISP
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:1610
query           LSHHVHS---------------------------------------------------------------
00505171   1/1  ----------------------------------------------------------------------
00500561   1/1  ----------------------------------------------------------------------
00507721   1/1  ----------------------------------------------------------------------
00408661   1/1  ----------------------------------------------------------------------
00521961   1/1  ----------------------------------------------------------------------
00505711   1/1  ----------------------------------------------------------------------
00470981   1/1  ----------------------------------------------------------------------
00511361   1/1  ----------------------------------------------------------------------
00535622   2/4  ----------------------------------------------------------------------
00535621   1/4  ----------------------------------------------------------------------
00535624   4/4  ----------------------------------------------------------------------
00535623   3/4  ----------------------------------------------------------------------