[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_02968


[Show Plain Result]

## Summary of Sequence Search
   1::963
   1::822  2.2e-34 19.5% 0050417 00504171 1/1   epeat                                   
   8::649  6.7e-16 20.5% 0052026 00520261 1/1   epeat                                   
   1::649  7.8e-12 23.9% 0048921 00489211 1/1   epeat                                   
  52::653  1.7e-06 20.2% 0049802 00498021 1/1   epeat                                   
 318::822    2e-05 19.8% 0045874 00458741 1/1   epeat                                   
   1::963


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEKQGDAPQLIREATELAQVLSAPGNASFVQTAQARLQTLQKSAAGWAIADSLLGSEDANVRFYGALTLT
00504171   1/1  Md..........dleqllqllyaspdpevrkqAeeqLeqlqkspefllllleilssssldpevrffAail
00520261   1/1  -------PmdleqllqlLqallsp.dnevrkqAeeqLkeleknnppefllllleilldsssdpeiRqlAa
00489211   1/1  Me.deldpldlqqllqlLeallsp.dnevrkqAeeqLkqlekspdfllllleiladlesldlevrqlAav
00498021   1/1  ---------------------------------------------------asellaellealkskdpdv
00458741   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           MKIHQDWANLGEQMVRDLLIRLVDCFLLLVNKNETPVVMRKFITSMTAMFFKPQAPWTHCIRHVAISLAN
00504171   1/1  Lknlikknwsslednnalpeeekeeiknsllqlli.....dspplvrnklaqalaeiakr..........
00520261   1/1  ilLknllkknwrptddefaerlwpaldeeekeqiknlllqlll.....epdplvrsaaaealaaia....
00489211   1/1  lLknlikknwpslpeeekeeikelllellk......dpdplvrnqaae......................
00498021   1/1  RlealqeLkkllkkgwee....lpeedlsellplllkll.sspdpevrkaaalaLanla...........
00458741   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GKYLPEEQADLQSFQTLVLPSLNYDRLLAVMSFSTTLAEESVRHAQNSSGYQDRLTANMNDAFFLINYSF
00504171   1/1  ..........dfpeewpellpdllqllqspnpelregalliLkelveel...rdlllsdelqkrrkllle
00520261   1/1  ................ridlpeglwpellplllellkspsdpelreaallalselleel........rel
00489211   1/1  ......................................................................
00498021   1/1  ..........kkldeellelllplLlkllsspdpevrelalraLasiakrlgpgaaspelveelldellp
00458741   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           QRAINNAQASANNVSSDQPTNTAQEAISSLQAWITAMRSVRVDRGALSSAVNVPISCAIRFLSEPRLAPN
00504171   1/1  lleedlpeilplllqlledssddvrllal.........................................
00520261   1/1  ..lqeileellplllkllevlls..........sdpspevrlaalkalgsllrsld..............
00489211   1/1  ......................................................................
00498021   1/1  lll..........................................................sllksdkdp
00458741   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           TMELLTDIILSQPKLLTPDHFTGIMDFLIGSDGEQYAMAILNGEFEDDQMRFLELLLRFASSETQIRVLT
00504171   1/1  ..........slevrklalkalgsllwidlpeifedlleellelllkllesldplleavdddeeleplek
00520261   1/1  ..............................sslefeelldqilelllell.........sdedeevrkaa
00489211   1/1  ......................................................................
00498021   1/1  evreaallalakllknlpelleplledllplllkllsdpdpevRkaAaealgallkklpdelleellpal
00458741   1/1  -------------------------------------lal....edeellelleellellkskdeevrls


                         -         -         -         -         *         -         -:420
query           HSPDEKHERILFLLFKLFHAPGVGAVEDMASNLLLEFWTEAADNISELIMEGAFDEPTLSVKENFTRVIA
00504171   1/1  vrkaaleclgelaslypsl......lgpyleqilplllkllqspdldplseevrlaaleflssllesepl
00520261   1/1  lkcLgrllely.pelllpyle.....kllelllkllskde.....dpevrlaaleflsslaksegkillk
00489211   1/1  ...........................alaaiarkdgpeewpellpellellss.....sdeelregall
00498021   1/1  lellkedpdpevrkaalelLgellesnpellksllp.ellplllkllsdpdpevrlaalellsalaellp
00458741   1/1  alkaLaeliralgpeedlsellplllkllespd..evrklallaLgellkllpelellelllplllkllk


                         -         -         +         -         -         -         -:490
query           ECFDKFRYPNPSVLSEWEDDDVKIFNTFRRDFSDFLLATYPLLGVPMIQQIQERAAVAIRDHDWERFEVA
00504171   1/1  kk........llltkpilpellellikpllklseedleeweddpeefirddlddddd..esvRraaaelL
00520261   1/1  aledkkeerrspellkpyleelvpvllkllsddde....deddde....wsvrraaadaldalasvlgde
00489211   1/1  aLgellee..lgslsesdalqelleeilplllkllsdpdpevrkaalkalgnlasflpeefedllnellp
00498021   1/1  ellkpllekllpallkllssdpdpevrkealdaleelledlpddlelliklledlddddpnvrraaleal
00458741   1/1  spdplvreaalralgsllellpppelledllplllkllkdkdpkvrkaalealgkllellpelllpellp


                         *         -         -         -         -         +         -:560
query           MFCLASLADTIAENKHADDLLHALFHSELFDAICFGRTDIPLKTRQTLSDMIAKYTPYFERNHNLLAPVL
00504171   1/1  grlakllpeevlplllplliqllssllngpsedwrvreaallalgslaqkeglpeegsteksdlv..pll
00520261   1/1  ilplllpfllellsssnwrvreaallalgslaegtpeeklkpllp..ellplllsllkdpnpevreaalw
00489211   1/1  lllellsspdpkvrkaalealgelaerypdflkpylpdllplllklledkdpevrlaaleflstlakqkl
00498021   1/1  gklakllpelllpfleellpallellsdpdpevreaalealgslaellgpdlledllpellslleslsel
00458741   1/1  lllkllsd.pdpevrkaaleaLgellknlpe....................................eel


                         -         -         -         *         -         -         -:630
query           NFLFSSLGMPSSEQAAAKSISSLCGTCRQPLTIYVEEFISKFAQLHANPSTNGHTLERVVEGIASVIQAV
00504171   1/1  pqllplllellkdgnvpnplvraaalealgrlaevl..gpefleellplllklLsdsdpevreaAaraLg
00520261   1/1  aLgrlaedlpevldnlelleqllpallkllkd...npevrraaasaLgnllelldplseedlepyleell
00489211   1/1  lpkllepyleellplllkllsldpedlelweddpeeyvrdededsderplsgkareavsdvleklleeed
00498021   1/1  leelleellplLlellnd.espevreaalkalgrlaeklpelleeylekllplllellsdedpseevrea
00458741   1/1  leellplllellkdpdpevrlaalkaLgalleglpe.........epllpkllplllellsdpspevraa


                         -         +         -         -         -         -         *:700
query           GSELGKANLLLKLLDPLCQEAKQARDISRTGQHEAGLASGFRVMGCTASIGKGLRAPEEFCINLDEESPD
00504171   1/1  sllesleeafvtlqvlfpeelepylpellpallklls..dpseevreaaelenalealgtlvkalpdelt
00520261   1/1  piLlkllkkqdpdpevrea---------------------------------------------------
00489211   1/1  edeededddddd..edwsv---------------------------------------------------
00498021   1/1  alsalgellenlspellvpyled-----------------------------------------------
00458741   1/1  alkalgkllsnlppeillekllplllellkdp..dpevreaaleaLgslleslpellspelyleellpll


                         -         -         -         -         +         -         -:770
query           RSAESDFWTGDPRATSLQSLIIQILEHLVNEFCADGDIIEGACDVLKAGYTEKSPGLTYLPLSDFHCYTS
00504171   1/1  p..yleellplllqllkells.................................................
00520261   1/1  ----------------------------------------------------------------------
00489211   1/1  ----------------------------------------------------------------------
00498021   1/1  ----------------------------------------------------------------------
00458741   1/1  lellsdp......dpevreaalealgklakllgneelaeellplLl........................


                         -         -         *         -         -         -         -:840
query           CRSFFSLIEAPQDKPEVVQAILHFTLVTLKGPDTLPLRAACSFWTTLLGLHDLPPAFTPDGLYKGQEQTA
00504171   1/1  .....ddedpevrlaalealgslakalgpeilspllekllplllellededp------------------
00520261   1/1  ----------------------------------------------------------------------
00489211   1/1  ----------------------------------------------------------------------
00498021   1/1  ----------------------------------------------------------------------
00458741   1/1  .................................kllk.de.dpevreaalea------------------


                         +         -         -         -         -         *         -:910
query           TAKPFDAYLAQLGDVVISQIAGKCARSELDHFSEVIKKFAFQHPGAAKMHLGNALVSLDASSNEAAGGPA
00504171   1/1  ----------------------------------------------------------------------
00520261   1/1  ----------------------------------------------------------------------
00489211   1/1  ----------------------------------------------------------------------
00498021   1/1  ----------------------------------------------------------------------
00458741   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           GQPGNNHNADSGVSKSERARFLASIFAVRGSRATNNLVREFWVSCRGKGFAYA-----------------
00504171   1/1  ----------------------------------------------------------------------
00520261   1/1  ----------------------------------------------------------------------
00489211   1/1  ----------------------------------------------------------------------
00498021   1/1  ----------------------------------------------------------------------
00458741   1/1  ----------------------------------------------------------------------