[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_02989


[Show Plain Result]

## Summary of Sequence Search
   1::1343
1098::1322 7.2e-68 40.5% 0042280 00422802 2/2   p containing nucleoside triphosphate hy 
 428::659  1.8e-66 42.2% 0042280 00422801 1/2   p containing nucleoside triphosphate hy 
1098::1343 1.2e-65 41.0% 0049080 00490802 2/2   p containing nucleoside triphosphate hy 
 428::697  2.8e-65 37.3% 0049080 00490801 1/2   p containing nucleoside triphosphate hy 
1098::1343 2.9e-65 40.5% 0051025 00510252 2/2   p containing nucleoside triphosphate hy 
 428::698  7.7e-65 38.0% 0051025 00510251 1/2   p containing nucleoside triphosphate hy 
1094::1340 4.1e-64 38.1% 0037958 00379582 2/2   p containing nucleoside triphosphate hy 
1071::1323 1.8e-63 41.2% 0042496 00424962 2/2   p containing nucleoside triphosphate hy 
1098::1336 6.2e-63 37.3% 0050943 00509432 2/2   p containing nucleoside triphosphate hy 
1098::1322 1.6e-62 39.5% 0036790 00367902 2/2   p containing nucleoside triphosphate hy 
 432::677    1e-61 39.7% 0048220 00482201 1/2   p containing nucleoside triphosphate hy 
 428::673  1.1e-61 38.8% 0050943 00509431 1/2   p containing nucleoside triphosphate hy 
1095::1340 1.1e-61 39.1% 0048220 00482202 2/2   p containing nucleoside triphosphate hy 
 432::676  2.8e-61 39.8% 0053059 00530591 1/2   p containing nucleoside triphosphate hy 
 428::677  2.9e-61 39.8% 0037958 00379581 1/2   p containing nucleoside triphosphate hy 
1096::1345 4.3e-61 37.2% 0045860 00458602 2/2   p containing nucleoside triphosphate hy 
1098::1339 4.4e-61 40.1% 0053059 00530592 2/2   p containing nucleoside triphosphate hy 
 428::659  7.9e-61 41.4% 0036790 00367901 1/2   p containing nucleoside triphosphate hy 
 432::682  1.4e-60 36.7% 0045860 00458601 1/2   p containing nucleoside triphosphate hy 
 432::678  2.6e-60 38.9% 0048226 00482261 1/2   p containing nucleoside triphosphate hy 
 411::660  2.8e-60 39.5% 0042496 00424961 1/2   p containing nucleoside triphosphate hy 
1097::1336 3.4e-60 38.3% 0037898 00378982 2/2   p containing nucleoside triphosphate hy 
1096::1341 4.8e-60 38.9% 0048226 00482262 2/2   p containing nucleoside triphosphate hy 
   3::413  5.5e-60 22.8% 0042281 00422811 1/2   ransporter transmembrane region         
1097::1337 9.9e-60 37.3% 0042070 00420702 2/2   p containing nucleoside triphosphate hy 
 432::673  1.4e-59 39.7% 0047599 00475991 1/2   p containing nucleoside triphosphate hy 
 432::674  2.2e-59 40.4% 0047589 00475891 1/2   p containing nucleoside triphosphate hy 
 418::670  2.9e-59 39.7% 0044086 00440861 1/2   p containing nucleoside triphosphate hy 
1092::1337 3.7e-59 38.8% 0047589 00475892 2/2   p containing nucleoside triphosphate hy 
1088::1333 5.3e-59 35.8% 0044086 00440862 2/2   p containing nucleoside triphosphate hy 
1102::1336 7.1e-59 38.0% 0047599 00475992 2/2   p containing nucleoside triphosphate hy 
 428::663  4.6e-58 42.5% 0037898 00378981 1/2   p containing nucleoside triphosphate hy 
 428::664  1.7e-57 41.9% 0042070 00420701 1/2   p containing nucleoside triphosphate hy 
 747::1257 4.6e-57 24.8% 0042281 00422812 2/2   ransporter transmembrane region         
1092::1338 1.1e-56 37.3% 0050044 00500442 2/2   p containing nucleoside triphosphate hy 
1098::1337 1.3e-56 38.2% 0042557 00425572 2/2   p containing nucleoside triphosphate hy 
1077::1326 1.5e-56 39.1% 0037960 00379602 2/2   p containing nucleoside triphosphate hy 
 429::678  1.9e-56 37.7% 0050274 00502741 1/2   p containing nucleoside triphosphate hy 
1096::1341   2e-56 36.4% 0050274 00502742 2/2   p containing nucleoside triphosphate hy 
 433::655  4.3e-56 36.7% 0039041 00390411 1/2   p containing nucleoside triphosphate hy 
1099::1335 4.3e-56 39.8% 0040410 00404102 2/2   p containing nucleoside triphosphate hy 
 432::663  7.4e-56 38.7% 0050044 00500441 1/2   p containing nucleoside triphosphate hy 
1100::1318 1.3e-55 36.0% 0039041 00390412 2/2   p containing nucleoside triphosphate hy 
 429::672  2.2e-55 41.6% 0040410 00404101 1/2   p containing nucleoside triphosphate hy 
 426::660  5.3e-55 38.9% 0046697 00466971 1/2   p containing nucleoside triphosphate hy 
 428::663  3.3e-54 43.0% 0037960 00379601 1/2   p containing nucleoside triphosphate hy 
1093::1323 3.4e-54 38.5% 0046697 00466972 2/2   p containing nucleoside triphosphate hy 
 428::663  5.2e-54 42.4% 0042557 00425571 1/2   p containing nucleoside triphosphate hy 
1095::1340 1.9e-53 35.9% 0046869 00468692 2/2   p containing nucleoside triphosphate hy 
 434::659  7.4e-52 37.3% 0046693 00466931 1/2   p containing nucleoside triphosphate hy 
 395::642  9.4e-52 37.2% 0043651 00436511 1/2   p containing nucleoside triphosphate hy 
1118::1333 1.3e-51 40.5% 0046860 00468602 2/2   p containing nucleoside triphosphate hy 
1098::1329   2e-51 38.5% 0036121 00361212 2/2   p containing nucleoside triphosphate hy 
1065::1304 3.3e-51 32.2% 0043651 00436512 2/2   p containing nucleoside triphosphate hy 
1110::1341 4.1e-51 36.9% 0048545 00485452 2/2   p containing nucleoside triphosphate hy 
1114::1322 4.7e-51 38.0% 0046693 00466932 2/2   p containing nucleoside triphosphate hy 
1121::1332 1.1e-50 41.8% 0048593 00485932 2/2   p containing nucleoside triphosphate hy 
 428::648  1.3e-50 36.4% 0043607 00436071 1/2   p containing nucleoside triphosphate hy 
1096::1311 1.4e-50 35.5% 0043607 00436072 2/2   p containing nucleoside triphosphate hy 
 448::670  3.1e-50 40.5% 0046860 00468601 1/2   p containing nucleoside triphosphate hy 
 428::661  3.4e-49 42.9% 0036121 00361211 1/2   p containing nucleoside triphosphate hy 
 439::663  4.6e-49 40.9% 0048545 00485451 1/2   p containing nucleoside triphosphate hy 
 428::677  1.6e-48 38.5% 0046869 00468691 1/2   p containing nucleoside triphosphate hy 
 451::669  3.4e-48 44.3% 0048593 00485931 1/2   p containing nucleoside triphosphate hy 
1116::1333 9.7e-48 39.8% 0044893 00448932 2/2   p containing nucleoside triphosphate hy 
  81::417  2.1e-47 23.1% 0053060 00530601 1/2   ransporter transmembrane region         
1098::1331 2.7e-47 40.2% 0042214 00422142 2/2   p containing nucleoside triphosphate hy 
 746::1111 6.9e-47 26.8% 0053060 00530602 2/2   ransporter transmembrane region         
1096::1331 1.2e-46 42.0% 0046945 00469452 2/2   p containing nucleoside triphosphate hy 
 428::660  2.6e-46 42.9% 0042214 00422141 1/2   p containing nucleoside triphosphate hy 
 426::668  7.3e-46 45.1% 0046945 00469451 1/2   p containing nucleoside triphosphate hy 
1092::1337 2.7e-45 31.5% 0036850 00368502 2/2   p containing nucleoside triphosphate hy 
 446::670  4.4e-45 40.8% 0044893 00448931 1/2   p containing nucleoside triphosphate hy 
1098::1328 6.8e-45 40.8% 0037230 00372302 2/2   p containing nucleoside triphosphate hy 
 454::651  1.3e-44 44.0% 0042605 00426051 1/2   p containing nucleoside triphosphate hy 
 428::662  5.2e-43 42.7% 0037230 00372301 1/2   p containing nucleoside triphosphate hy 
 402::666  5.7e-43 33.3% 0049825 00498251 1/2   p containing nucleoside triphosphate hy 
1124::1314 8.2e-43 42.4% 0042605 00426052 2/2   p containing nucleoside triphosphate hy 
1095::1324 2.4e-42 37.1% 0036748 00367482 2/2   p containing nucleoside triphosphate hy 
1095::1329 4.3e-42 35.3% 0049825 00498252 2/2   p containing nucleoside triphosphate hy 
 428::661  1.2e-41 36.1% 0036748 00367481 1/2   p containing nucleoside triphosphate hy 
1115::1335 1.7e-41 38.0% 0047537 00475372 2/2   p containing nucleoside triphosphate hy 
 424::669  5.7e-41 39.7% 0043798 00437981 1/2   p containing nucleoside triphosphate hy 
 445::676  5.9e-41 35.4% 0047537 00475371 1/2   p containing nucleoside triphosphate hy 
1094::1330 1.8e-40 37.5% 0043798 00437982 2/2   p containing nucleoside triphosphate hy 
 422::674    2e-40 29.8% 0036850 00368501 1/2   p containing nucleoside triphosphate hy 
 432::659  1.4e-39 40.6% 0049611 00496111 1/2   p containing nucleoside triphosphate hy 
1097::1335 2.9e-39 34.2% 0048852 00488522 2/2   p containing nucleoside triphosphate hy 
 418::663  7.3e-39 35.1% 0048852 00488521 1/2   p containing nucleoside triphosphate hy 
 443::662  4.2e-38 42.2% 0053253 00532531 1/2   arboxykinase-like                       
1058::1321 2.6e-37 28.0% 0037163 00371632 2/2   p containing nucleoside triphosphate hy 
1099::1322   1e-36 37.8% 0049611 00496112 2/2   p containing nucleoside triphosphate hy 
 421::663  1.1e-36 37.5% 0049537 00495371 1/2   p containing nucleoside triphosphate hy 
 445::662  1.4e-36 34.3% 0050337 00503371 1/2   p containing nucleoside triphosphate hy 
1042::1324 5.3e-36 30.8% 0046479 00464792 2/2   p containing nucleoside triphosphate hy 
 388::658  2.5e-35 29.8% 0037163 00371631 1/2   p containing nucleoside triphosphate hy 
1091::1327 3.7e-35 35.6% 0049537 00495372 2/2   p containing nucleoside triphosphate hy 
1115::1325 1.1e-34 32.9% 0050337 00503372 2/2   p containing nucleoside triphosphate hy 
 456::622  2.1e-34 41.7% 0038144 00381441 1/2   p containing nucleoside triphosphate hy 
1121::1296 2.7e-34 43.9% 0045157 00451572 2/2   p containing nucleoside triphosphate hy 
1113::1326 2.9e-34 36.5% 0053253 00532532 2/2   arboxykinase-like                       
1120::1270 5.7e-34 44.8% 0048047 00480472 2/2   p containing nucleoside triphosphate hy 
 454::660  7.7e-34 39.3% 0045731 00457311 1/2   p containing nucleoside triphosphate hy 
 450::607  2.4e-33 41.7% 0048047 00480471 1/2   p containing nucleoside triphosphate hy 
 418::663  9.4e-33 34.3% 0050061 00500611 1/2   p containing nucleoside triphosphate hy 
 452::633    1e-32 43.6% 0045157 00451571 1/2   p containing nucleoside triphosphate hy 
1091::1329 1.1e-32 37.3% 0043794 00437942 2/2   p containing nucleoside triphosphate hy 
1091::1329 2.3e-32 30.9% 0049503 00495032 2/2   p containing nucleoside triphosphate hy 
 421::663  2.9e-32 35.2% 0049503 00495031 1/2   p containing nucleoside triphosphate hy 
1126::1284 3.1e-32 37.4% 0038144 00381442 2/2   p containing nucleoside triphosphate hy 
 421::666    5e-32 37.3% 0043794 00437941 1/2   p containing nucleoside triphosphate hy 
1088::1329 9.1e-32 32.2% 0050061 00500612 2/2   p containing nucleoside triphosphate hy 
 372::656  5.3e-31 30.3% 0046479 00464791 1/2   p containing nucleoside triphosphate hy 
1124::1324 2.6e-30 38.4% 0041412 00414122 2/2   p containing nucleoside triphosphate hy 
 440::657    3e-30 35.8% 0046276 00462761 1/2   p containing nucleoside triphosphate hy 
 448::669  6.3e-30 32.5% 0049073 00490731 1/2   p containing nucleoside triphosphate hy 
 454::661  4.1e-29 39.5% 0041412 00414121 1/2   p containing nucleoside triphosphate hy 
1124::1323 6.9e-29 34.3% 0045731 00457312 2/2   p containing nucleoside triphosphate hy 
1118::1331 1.8e-28 32.7% 0049073 00490732 2/2   p containing nucleoside triphosphate hy 
1125::1272 3.8e-28 33.8% 0048410 00484102 2/2   p containing nucleoside triphosphate hy 
1110::1320 5.6e-28 33.0% 0046276 00462762 2/2   p containing nucleoside triphosphate hy 
1112::1295 7.1e-28 40.5% 0047552 00475522 2/2   arboxykinase-like                       
1112::1317 5.1e-27 36.5% 0047841 00478412 2/2   arboxykinase-like                       
 454::611  6.1e-27 40.8% 0047538 00475381 1/2   p containing nucleoside triphosphate hy 
 442::632    3e-26 43.0% 0047552 00475521 1/2   arboxykinase-like                       
 442::640    7e-26 38.5% 0047841 00478411 1/2   arboxykinase-like                       
1100::1331 8.7e-26 32.6% 0037996 00379962 2/2   p containing nucleoside triphosphate hy 
 457::659  9.7e-26 34.1% 0051289 00512891 1/2   p containing nucleoside triphosphate hy 
1127::1322 1.9e-25 31.7% 0051289 00512892 2/2   p containing nucleoside triphosphate hy 
 428::663  7.5e-25 29.8% 0037996 00379961 1/2   p containing nucleoside triphosphate hy 
1125::1274 1.4e-24 39.5% 0047538 00475382 2/2   p containing nucleoside triphosphate hy 
1093::1338 3.3e-24 27.0% 0037926 00379262 2/2   p containing nucleoside triphosphate hy 
 447::671  3.8e-24 29.3% 0036857 00368571 1/2   p containing nucleoside triphosphate hy 
 446::648  3.9e-24 30.9% 0043440 00434401 1/2   p containing nucleoside triphosphate hy 
1091::1217 4.8e-24 27.9% 0038720 00387202 2/2   p containing nucleoside triphosphate hy 
 455::609  1.1e-23 34.2% 0048410 00484101 1/2   p containing nucleoside triphosphate hy 
1125::1336 1.1e-23 29.1% 0053350 00533502 2/2   p containing nucleoside triphosphate hy 
1103::1313 1.3e-23 27.7% 0036857 00368572 2/2   p containing nucleoside triphosphate hy 
1128::1343 1.3e-22 28.9% 0048702 00487022 2/2   p containing nucleoside triphosphate hy 
 421::554  3.3e-22 32.8% 0038720 00387201 1/2   p containing nucleoside triphosphate hy 
1090::1326 3.6e-22 35.9% 0044438 00444382 2/2   p containing nucleoside triphosphate hy 
1112::1298 3.6e-22 30.3% 0047844 00478442 2/2   arboxykinase-like                       
1124::1318 6.2e-22 27.5% 0049881 00498812 2/2   p containing nucleoside triphosphate hy 
1109::1310 8.4e-22 30.8% 0043440 00434402 2/2   p containing nucleoside triphosphate hy 
1099::1337 1.6e-21 28.2% 0050374 00503742 2/2   p containing nucleoside triphosphate hy 
 456::663  3.4e-21 34.6% 0053350 00533501 1/2   p containing nucleoside triphosphate hy 
 442::635  3.5e-21 33.7% 0047844 00478441 1/2   arboxykinase-like                       
 455::628    5e-21 32.3% 0051553 00515531 1/2   p containing nucleoside triphosphate hy 
 432::687  6.5e-21 24.0% 0048957 00489571 1/2   p containing nucleoside triphosphate hy 
1125::1291 1.1e-20 33.1% 0051553 00515532 2/2   p containing nucleoside triphosphate hy 
1125::1330 2.1e-20 31.7% 0049343 00493432 2/2   p containing nucleoside triphosphate hy 
 457::679  3.3e-20 24.0% 0051376 00513761 1/2   p containing nucleoside triphosphate hy 
1124::1308 3.6e-20 34.9% 0047797 00477972 2/2   p containing nucleoside triphosphate hy 
 455::667  4.1e-20 31.6% 0049343 00493431 1/2   p containing nucleoside triphosphate hy 
1120::1343 4.3e-20 23.5% 0047073 00470732 2/2   p containing nucleoside triphosphate hy 
 417::663  4.7e-20 25.2% 0037926 00379261 1/2   p containing nucleoside triphosphate hy 
1127::1333 5.5e-20 20.9% 0051376 00513762 2/2   p containing nucleoside triphosphate hy 
 453::655  5.8e-20 30.0% 0049881 00498811 1/2   p containing nucleoside triphosphate hy 
1101::1340 5.9e-20 27.5% 0048957 00489572 2/2   p containing nucleoside triphosphate hy 
1081::1327 6.4e-20 35.5% 0039270 00392702 2/2   p containing nucleoside triphosphate hy 
 453::663  7.1e-20 35.9% 0046441 00464411 1/2   p containing nucleoside triphosphate hy 
 446::655  1.1e-19 27.4% 0051056 00510561 1/2   p containing nucleoside triphosphate hy 
 445::663  1.4e-19 34.2% 0044438 00444381 1/2   p containing nucleoside triphosphate hy 
1125::1313 1.6e-19 30.8% 0049657 00496572 2/2   p containing nucleoside triphosphate hy 
 433::633  1.7e-19 28.8% 0035641 00356411 1/2   p containing nucleoside triphosphate hy 
1114::1316 1.8e-19 36.4% 0040678 00406782 2/2   p containing nucleoside triphosphate hy 
 454::648  2.1e-19 34.9% 0047797 00477971 1/2   p containing nucleoside triphosphate hy 
 456::680  3.8e-19 29.6% 0049919 00499191 1/2   p containing nucleoside triphosphate hy 
 456::658    4e-19 35.1% 0049657 00496571 1/2   p containing nucleoside triphosphate hy 
 429::690  4.2e-19 26.4% 0050374 00503741 1/2   p containing nucleoside triphosphate hy 
1116::1318 4.7e-19 29.9% 0047701 00477012 2/2   p containing nucleoside triphosphate hy 
1125::1310 7.2e-19 30.4% 0049919 00499192 2/2   p containing nucleoside triphosphate hy 
1100::1296 1.5e-18 32.0% 0035641 00356412 2/2   p containing nucleoside triphosphate hy 
1125::1288 2.8e-18 33.6% 0051551 00515512 2/2   p containing nucleoside triphosphate hy 
 453::685  2.9e-18 27.8% 0048702 00487021 1/2   p containing nucleoside triphosphate hy 
1092::1311 3.2e-18 34.7% 0040419 00404192 2/2   p containing nucleoside triphosphate hy 
1123::1270 3.2e-18 38.5% 0046441 00464412 2/2   p containing nucleoside triphosphate hy 
1116::1319 3.5e-18 30.1% 0046895 00468952 2/2   p containing nucleoside triphosphate hy 
1116::1331 4.8e-18 26.6% 0051056 00510562 2/2   p containing nucleoside triphosphate hy 
 455::680  9.8e-18 22.7% 0047073 00470731 1/2   p containing nucleoside triphosphate hy 
1086::1303 1.1e-17 35.4% 0042094 00420942 2/2   p containing nucleoside triphosphate hy 
 453::692  1.2e-17 27.1% 0046895 00468951 1/2   p containing nucleoside triphosphate hy 
 453::692  1.3e-17 26.4% 0049853 00498531 1/2   p containing nucleoside triphosphate hy 
1126::1320 1.3e-17 29.0% 0040588 00405882 2/2   p containing nucleoside triphosphate hy 
 429::657  2.1e-17 25.0% 0043986 00439861 1/2   p containing nucleoside triphosphate hy 
 455::681  2.5e-17 29.9% 0053247 00532471 1/2   p containing nucleoside triphosphate hy 
 422::687  2.7e-17 26.1% 0040419 00404191 1/2   p containing nucleoside triphosphate hy 
1075::1331   3e-17 22.9% 0049853 00498532 2/2   p containing nucleoside triphosphate hy 
1123::1327 3.4e-17 24.8% 0043986 00439862 2/2   p containing nucleoside triphosphate hy 
1104::1286   4e-17 35.6% 0050867 00508672 2/2   p containing nucleoside triphosphate hy 
 455::625  4.8e-17 34.4% 0051551 00515511 1/2   p containing nucleoside triphosphate hy 
 448::660    5e-17 21.1% 0048025 00480251 1/2   p containing nucleoside triphosphate hy 
 456::652  6.6e-17 27.8% 0048963 00489631 1/2   p containing nucleoside triphosphate hy 
 445::691  7.7e-17 30.0% 0040678 00406781 1/2   p containing nucleoside triphosphate hy 
 388::568  1.3e-16 26.8% 0049577 00495771 1/2   p containing nucleoside triphosphate hy 
1113::1325 1.8e-16 29.0% 0051325 00513252 2/2   p containing nucleoside triphosphate hy 
 434::655  2.5e-16 25.0% 0047701 00477011 1/2   p containing nucleoside triphosphate hy 
1125::1336 3.4e-16 25.6% 0048963 00489632 2/2   p containing nucleoside triphosphate hy 
1125::1308 4.8e-16 29.2% 0053247 00532472 2/2   p containing nucleoside triphosphate hy 
1111::1303 6.1e-16 33.6% 0043790 00437902 2/2   p containing nucleoside triphosphate hy 
 456::657    8e-16 29.1% 0040588 00405881 1/2   p containing nucleoside triphosphate hy 
 414::651  9.8e-16 30.8% 0039270 00392701 1/2   p containing nucleoside triphosphate hy 
1120::1296 1.1e-15 38.7% 0043218 00432182 2/2   p containing nucleoside triphosphate hy 
1085::1298 1.7e-15 27.6% 0039472 00394722 2/2   p containing nucleoside triphosphate hy 
 443::662  1.8e-15 27.5% 0051325 00513251 1/2   p containing nucleoside triphosphate hy 
1120::1331 2.1e-15 21.0% 0053315 00533152 2/2   p containing nucleoside triphosphate hy 
1120::1310 2.5e-15 28.7% 0049933 00499332 2/2   p containing nucleoside triphosphate hy 
 453::628  2.7e-15 36.2% 0050867 00508671 1/2   p containing nucleoside triphosphate hy 
 416::687  3.7e-15 28.4% 0042094 00420941 1/2   p containing nucleoside triphosphate hy 
1126::1326 4.5e-15 23.9% 0048272 00482722 2/2   p containing nucleoside triphosphate hy 
1089::1303 6.6e-15 29.2% 0036729 00367292 2/2   p containing nucleoside triphosphate hy 
1118::1322 1.4e-14 26.8% 0048025 00480252 2/2   p containing nucleoside triphosphate hy 
1083::1297 4.3e-14 30.0% 0040237 00402372 2/2   p containing nucleoside triphosphate hy 
1099::1303 5.9e-14 33.3% 0038674 00386742 2/2   p containing nucleoside triphosphate hy 
 450::633  8.8e-14 34.3% 0043218 00432181 1/2   p containing nucleoside triphosphate hy 
1113::1298 1.6e-13 33.3% 0043792 00437922 2/2   p containing nucleoside triphosphate hy 
1032::1231 2.4e-13 24.9% 0049577 00495772 2/2   p containing nucleoside triphosphate hy 
 456::663  7.6e-13 26.8% 0048272 00482721 1/2   p containing nucleoside triphosphate hy 
 419::640  9.2e-13 25.7% 0036729 00367291 1/2   p containing nucleoside triphosphate hy 
1127::1330 1.2e-12 26.1% 0048044 00480442 2/2   p containing nucleoside triphosphate hy 
1119::1303 1.4e-12 40.4% 0052155 00521552 2/2   p containing nucleoside triphosphate hy 
1125::1267 1.6e-12 30.9% 0046162 00461622 2/2   p containing nucleoside triphosphate hy 
 421::636  2.2e-12 25.8% 0039472 00394721 1/2   p containing nucleoside triphosphate hy 
 405::631  2.6e-12 26.8% 0040237 00402371 1/2   p containing nucleoside triphosphate hy 
1124::1341 2.8e-12 25.4% 0051535 00515352 2/2   p containing nucleoside triphosphate hy 
1104::1309   4e-12 28.6% 0041617 00416172 2/2   p containing nucleoside triphosphate hy 
 445::635  4.3e-12 33.0% 0043792 00437921 1/2   p containing nucleoside triphosphate hy 
1098::1303   5e-12 30.4% 0047394 00473942 2/2   p containing nucleoside triphosphate hy 
1122::1242 6.3e-12 29.7% 0042008 00420082 2/2   p containing nucleoside triphosphate hy 
 457::663  7.3e-12 29.6% 0046916 00469161 1/2   p containing nucleoside triphosphate hy 
1126::1312 9.7e-12 25.6% 0047808 00478082 2/2   p containing nucleoside triphosphate hy 
 456::687    1e-11 27.4% 0047808 00478081 1/2   p containing nucleoside triphosphate hy 
1126::1318 1.2e-11 23.6% 0049606 00496062 2/2   p containing nucleoside triphosphate hy 
1113::1305 1.3e-11 25.5% 0052726 00527262 2/2   p containing nucleoside triphosphate hy 
1120::1303 1.5e-11 30.3% 0051138 00511382 2/2   p containing nucleoside triphosphate hy 
1125::1310 2.1e-11 26.4% 0047607 00476072 2/2   p containing nucleoside triphosphate hy 
 447::635  2.2e-11 31.6% 0043790 00437901 1/2   p containing nucleoside triphosphate hy 
1125::1334 2.6e-11 22.9% 0045785 00457852 2/2   p containing nucleoside triphosphate hy 
 450::669  5.5e-11 23.8% 0049933 00499331 1/2   p containing nucleoside triphosphate hy 
1116::1303 6.4e-11 27.1% 0043012 00430122 2/2   p containing nucleoside triphosphate hy 
 443::640  8.4e-11 33.9% 0038674 00386741 1/2   p containing nucleoside triphosphate hy 
1122::1333   9e-11 22.6% 0047291 00472912 2/2   p containing nucleoside triphosphate hy 
 445::633  2.1e-10 26.0% 0052726 00527261 1/2   p containing nucleoside triphosphate hy 
 454::604  2.6e-10 31.5% 0046162 00461621 1/2   p containing nucleoside triphosphate hy 
1090::1292 2.9e-10 28.3% 0041830 00418302 2/2   p containing nucleoside triphosphate hy 
1124::1345 4.6e-10 24.4% 0048706 00487062 2/2   p containing nucleoside triphosphate hy 
 452::572  4.7e-10 28.1% 0042008 00420081 1/2   p containing nucleoside triphosphate hy 
 455::677  6.9e-10 25.9% 0048706 00487061 1/2   p containing nucleoside triphosphate hy 
1122::1272 1.5e-09 28.3% 0047839 00478392 2/2   p containing nucleoside triphosphate hy 
1101::1307 1.6e-09 23.8% 0048266 00482662 2/2   p containing nucleoside triphosphate hy 
 453::683  2.3e-09 20.0% 0047291 00472911 1/2   p containing nucleoside triphosphate hy 
 420::631  2.8e-09 25.0% 0041830 00418301 1/2   p containing nucleoside triphosphate hy 
1122::1263 3.4e-09 24.3% 0051604 00516042 2/2   p containing nucleoside triphosphate hy 
 450::647  4.2e-09 27.3% 0051138 00511381 1/2   p containing nucleoside triphosphate hy 
1119::1265 6.5e-09 33.0% 0051769 00517692 2/2   p containing nucleoside triphosphate hy 
 434::646  6.8e-09 22.1% 0041617 00416171 1/2   p containing nucleoside triphosphate hy 
 457::655  8.5e-09 23.5% 0048044 00480441 1/2   p containing nucleoside triphosphate hy 
1127::1264 1.2e-08 25.6% 0046916 00469162 2/2   p containing nucleoside triphosphate hy 
 446::631  1.5e-08 28.1% 0043012 00430121 1/2   p containing nucleoside triphosphate hy 
 445::640  1.6e-08 27.5% 0047394 00473941 1/2   p containing nucleoside triphosphate hy 
 456::600  1.6e-08 29.3% 0051604 00516041 1/2   p containing nucleoside triphosphate hy 
 420::631  1.9e-08 33.1% 0052155 00521551 1/2   p containing nucleoside triphosphate hy 
 456::655  2.4e-08 23.7% 0049606 00496061 1/2   p containing nucleoside triphosphate hy 
1119::1284 2.6e-08 34.9% 0040984 00409842 2/2   p containing nucleoside triphosphate hy 
 456::675  3.1e-08 23.0% 0050989 00509891 1/2   p containing nucleoside triphosphate hy 
 446::689  3.8e-08 23.3% 0053315 00533151 1/2   p containing nucleoside triphosphate hy 
 456::649  8.2e-08 25.9% 0047607 00476071 1/2   p containing nucleoside triphosphate hy 
1121::1166 9.3e-08 38.5% 0048939 00489392 2/2   p containing nucleoside triphosphate hy 
 456::650  1.1e-07 26.5% 0051535 00515351 1/2   p containing nucleoside triphosphate hy 
1116::1309   2e-07 27.5% 0049757 00497572 2/2   p containing nucleoside triphosphate hy 
 453::640  2.3e-07 28.9% 0048266 00482661 1/2   p containing nucleoside triphosphate hy 
1126::1169 2.8e-07 39.0% 0047813 00478132 2/2   p containing nucleoside triphosphate hy 
1114::1301 3.2e-07 28.7% 0041053 00410532 2/2   p containing nucleoside triphosphate hy 
1126::1265   5e-07 23.6% 0049317 00493172 2/2   p containing nucleoside triphosphate hy 
 453::681  5.1e-07 25.7% 0047839 00478391 1/2   p containing nucleoside triphosphate hy 
 446::646  7.5e-07 22.5% 0049757 00497571 1/2   p containing nucleoside triphosphate hy 
 456::491  7.6e-07 50.0% 0047813 00478131 1/2   p containing nucleoside triphosphate hy 
 449::650  8.3e-07 26.7% 0051769 00517691 1/2   p containing nucleoside triphosphate hy 
1124::1166 8.3e-07 40.5% 0051206 00512062 2/2   p containing nucleoside triphosphate hy 
1080::1265 8.9e-07 27.9% 0040238 00402382 2/2   p containing nucleoside triphosphate hy 
1124::1166 1.3e-06 33.3% 0049190 00491902 2/2   p containing nucleoside triphosphate hy 
1125::1269 1.4e-06 23.5% 0045788 00457882 2/2   p containing nucleoside triphosphate hy 
1125::1273 1.4e-06 25.8% 0051958 00519582 2/2   p containing nucleoside triphosphate hy 
1126::1166 2.2e-06 32.4% 0047772 00477722 2/2   p containing nucleoside triphosphate hy 
1093::1310 2.5e-06 25.0% 0046258 00462582 2/2   p containing nucleoside triphosphate hy 
1126::1265 2.6e-06 30.6% 0048050 00480502 2/2   p containing nucleoside triphosphate hy 
1127::1263 2.7e-06 24.8% 0048692 00486922 2/2   p containing nucleoside triphosphate hy 
 455::610  2.8e-06 28.1% 0051958 00519581 1/2   p containing nucleoside triphosphate hy 
1125::1166 2.8e-06 31.6% 0049398 00493982 2/2   p containing nucleoside triphosphate hy 
 449::678  3.9e-06 25.4% 0040984 00409841 1/2   p containing nucleoside triphosphate hy 
1127::1271 5.1e-06 34.8% 0050194 00501942 2/2   p containing nucleoside triphosphate hy 
 456::648    7e-06 25.4% 0048381 00483811 1/2   p containing nucleoside triphosphate hy 
1126::1278 7.1e-06 22.6% 0050989 00509892 2/2   p containing nucleoside triphosphate hy 
1124::1166   9e-06 37.2% 0047756 00477562 2/2   p containing nucleoside triphosphate hy 
1126::1302 9.2e-06 22.1% 0048381 00483812 2/2   p containing nucleoside triphosphate hy 
 454::560  9.4e-06 27.5% 0051206 00512061 1/2   p containing nucleoside triphosphate hy 
 454::607  1.4e-05 25.8% 0045785 00457851 1/2   p containing nucleoside triphosphate hy 
 455::489  1.4e-05 40.0% 0045970 00459701 1/2   p containing nucleoside triphosphate hy 
1110::1146 1.6e-05 32.4% 0041032 00410322 2/2   p containing nucleoside triphosphate hy 
1125::1282 1.8e-05 19.6% 0048689 00486892 2/2   p containing nucleoside triphosphate hy 
1123::1327 2.1e-05 24.0% 0048255 00482552 2/2   p containing nucleoside triphosphate hy 
1126::1166 3.2e-05 33.3% 0047933 00479332 2/2   p containing nucleoside triphosphate hy 
 453::655  3.6e-05 22.3% 0048255 00482551 1/2   p containing nucleoside triphosphate hy 
1113::1146 3.8e-05 47.1% 0047127 00471272 2/2   p containing nucleoside triphosphate hy 
1127::1169 5.5e-05 33.3% 0051580 00515802 2/2   p containing nucleoside triphosphate hy 
1122::1266 5.7e-05 34.4% 0040121 00401212 2/2   p containing nucleoside triphosphate hy 
 455::487  5.9e-05 45.5% 0049317 00493171 1/2   p containing nucleoside triphosphate hy 
1127::1164 7.6e-05 41.2% 0051851 00518512 2/2   p containing nucleoside triphosphate hy 
 444::638  8.3e-05 26.0% 0041053 00410531 1/2   p containing nucleoside triphosphate hy 
1096::1204 8.7e-05 16.0% 0044125 00441252 2/2   p containing nucleoside triphosphate hy 
1125::1289 8.7e-05 25.5% 0037884 00378842 2/2   p containing nucleoside triphosphate hy 
 456::494  9.7e-05 41.0% 0047756 00477561 1/2   p containing nucleoside triphosphate hy 
 456::481  9.8e-05 38.5% 0047772 00477721 1/2   p containing nucleoside triphosphate hy 
1125::1195 0.00011 24.6% 0046459 00464592 2/2   p containing nucleoside triphosphate hy 
 446::602  0.00013 31.4% 0048050 00480501 1/2   p containing nucleoside triphosphate hy 
1124::1164 0.00015 41.0% 0046442 00464422 2/2   p containing nucleoside triphosphate hy 
1109::1172 0.00016 23.8% 0037385 00373852 2/2   p containing nucleoside triphosphate hy 
1111::1146 0.00016 44.4% 0037862 00378622 2/2   p containing nucleoside triphosphate hy 
1126::1166 0.00016 34.1% 0045970 00459702 2/2   p containing nucleoside triphosphate hy 
1127::1166 0.00017 30.6% 0049306 00493062 2/2   p containing nucleoside triphosphate hy 
 453::647  0.00018 27.2% 0044125 00441251 1/2   p containing nucleoside triphosphate hy 
 453::494  0.00018 34.2% 0048939 00489391 1/2   p containing nucleoside triphosphate hy 
1100::1303 0.00051 21.1% 0047665 00476652 2/2   p containing nucleoside triphosphate hy 
 455::481  0.00056 42.3% 0047933 00479331 1/2   p containing nucleoside triphosphate hy 
 454::494  0.00076 38.5% 0046442 00464421 1/2   p containing nucleoside triphosphate hy 
1113::1303 0.00076 24.6% 0047420 00474202 2/2   p containing nucleoside triphosphate hy 
1114::1158 0.00077 35.6% 0045376 00453762 2/2   p containing nucleoside triphosphate hy 
 457::506  0.00079 28.0% 0036095 00360951 1/2   p containing nucleoside triphosphate hy 
 440::476  0.00092 29.7% 0041032 00410321 1/2   p containing nucleoside triphosphate hy 
 454::481   0.0011 44.4% 0045788 00457881 1/2   p containing nucleoside triphosphate hy 
 454::481   0.0011 39.3% 0049190 00491901 1/2   p containing nucleoside triphosphate hy 
1125::1284  0.0011 27.8% 0040315 00403152 2/2   p containing nucleoside triphosphate hy 
 439::499   0.0013 25.0% 0037385 00373851 1/2   p containing nucleoside triphosphate hy 
 457::481   0.0014 36.0% 0048689 00486891 1/2   p containing nucleoside triphosphate hy 
 456::481   0.0017 38.5% 0049398 00493981 1/2   p containing nucleoside triphosphate hy 
 457::686   0.0017 25.8% 0046315 00463151 1/2   p containing nucleoside triphosphate hy 
 457::481   0.0018 40.0% 0046459 00464591 1/2   p containing nucleoside triphosphate hy 
 439::476   0.0026 43.2% 0049506 00495061 1/2   p containing nucleoside triphosphate hy 
 457::663   0.0027 26.7% 0050194 00501941 1/2   p containing nucleoside triphosphate hy 
1111::1146  0.0029 33.3% 0038732 00387322 2/2   p containing nucleoside triphosphate hy 
1113::1146  0.0031 47.1% 0048819 00488192 2/2   p containing nucleoside triphosphate hy 
 454::487   0.0038 47.1% 0050317 00503171 1/2   p containing nucleoside triphosphate hy 
1123::1146  0.0042 52.2% 0049506 00495062 2/2   p containing nucleoside triphosphate hy 
1124::1286  0.0043 24.3% 0050317 00503172 2/2   p containing nucleoside triphosphate hy 
1127::1334  0.0043 24.2% 0046315 00463152 2/2   p containing nucleoside triphosphate hy 
 457::481   0.0044 52.0% 0051851 00518511 1/2   p containing nucleoside triphosphate hy 
1117::1165  0.0045 30.6% 0041400 00414002 2/2   p containing nucleoside triphosphate hy 
1102::1152  0.0053 30.6% 0047023 00470232 2/2   p containing nucleoside triphosphate hy 
 457::675   0.0055 22.3% 0048692 00486921 1/2   p containing nucleoside triphosphate hy 
 441::476   0.0072 33.3% 0037862 00378621 1/2   p containing nucleoside triphosphate hy 
 457::481   0.0073 40.0% 0051580 00515801 1/2   p containing nucleoside triphosphate hy 
 452::648    0.011 27.6% 0040121 00401211 1/2   p containing nucleoside triphosphate hy 
 445::476    0.015 40.6% 0047127 00471271 1/2   p containing nucleoside triphosphate hy 
 457::481    0.015 36.0% 0049306 00493061 1/2   p containing nucleoside triphosphate hy 
1124::1169   0.016 34.2% 0050316 00503162 2/2   p containing nucleoside triphosphate hy 
 435::506     0.02 29.2% 0045376 00453761 1/2   p containing nucleoside triphosphate hy 
 456::499    0.024 34.1% 0038794 00387941 1/2   p containing nucleoside triphosphate hy 
 454::483    0.027 55.2% 0050316 00503161 1/2   p containing nucleoside triphosphate hy 
 423::602    0.032 26.5% 0046258 00462581 1/2   p containing nucleoside triphosphate hy 
 432::495    0.037 29.0% 0047023 00470231 1/2   p containing nucleoside triphosphate hy 
1124::1146   0.042 43.5% 0048426 00484262 2/2   p containing nucleoside triphosphate hy 
 457::633    0.058 24.0% 0047420 00474201 1/2   p containing nucleoside triphosphate hy 
1129::1146   0.089 55.6% 0052346 00523462 2/2   p containing nucleoside triphosphate hy 
1119::1146    0.14 39.3% 0034832 00348322 2/2   p containing nucleoside triphosphate hy 
 441::476     0.18 25.0% 0038732 00387321 1/2   p containing nucleoside triphosphate hy 
 449::489     0.19 42.1% 0034832 00348321 1/2   p containing nucleoside triphosphate hy 
 456::476     0.21 45.0% 0052346 00523461 1/2   p containing nucleoside triphosphate hy 
 447::495     0.27 22.4% 0041400 00414001 1/2   p containing nucleoside triphosphate hy 
 445::476     0.28 34.4% 0048819 00488191 1/2   p containing nucleoside triphosphate hy 
1126::1172    0.51 23.4% 0038794 00387942 2/2   p containing nucleoside triphosphate hy 
 457::637     0.67 20.0% 0047665 00476651 1/2   p containing nucleoside triphosphate hy 
 454::476     0.69 39.1% 0048426 00484261 1/2   p containing nucleoside triphosphate hy 
 412::618     0.73 19.1% 0040238 00402381 1/2   p containing nucleoside triphosphate hy 
1127::1146    0.75 45.0% 0036095 00360952 2/2   p containing nucleoside triphosphate hy 
 455::476      1.5 45.5% 0040315 00403151 1/2   p containing nucleoside triphosphate hy 
 455::473      2.8 47.4% 0037884 00378841 1/2   p containing nucleoside triphosphate hy 
   1::1343


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAGDPEKPSETAAQLAVQKTSNSSPGTGPSSASGSTVGDGDNLKKLDSKLANEKRESNLDDSLAHLPEHE
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00422811   1/2  --ekeekr..............................................................
00420702   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00378842   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00360951   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00373851   1/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RDIIKQQLEIPETKVKFFTLYRYATTNDIIILLVSAVASIAGGAALPLFTILFGQMAGTFQRIILGTISY
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00422811   1/2  ...................llrylkp.ykkllllalllallaallslllplllgrlidall........p
00420702   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------ep.k.Rllrylk....pykkllllalllsllaallslllplllgqlidalll...gg.dl
00422142   2/2  ----------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00378842   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00360951   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00373851   1/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DEFNDTLSKYALYFVYLGIAEFVLIYTCTVGFIYTGEHIAQKIRERYLDAVLRQNIAFFDKLGAGEITTR
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00422811   1/2  ggdlslllllallllllallrallsylrsyllarlgqrllarlrsrlfrkllrlplsffdktstGdllsr
00420702   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00530601   1/2  sdpllllstlllllllllllallrallsylrsyllarlgqrlsarlrlrlfrkllrlplsffdktstGdl
00422142   2/2  ----------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00378842   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00360951   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00373851   1/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ITADTNLIQDGISEKVGLTLTALATFVTAFVIGFIKYWKLTLICCSTVVAIVTIMGGASRFIIRFSKKNV
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00422811   1/2  ltnDveaidellssllltllralltllgalivlfylswrlalvlllllpllllltllfgkrlrklsrlvq
00420702   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00530601   1/2  lsrltnDveaidellssllltlllalltligalivlfliswklalvlllllpllllltllfgkrlrklsr
00422142   2/2  ----------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00378842   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00360951   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00373851   1/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ESYGEGGTVAEEVLSSIRNATAFGTQEKLAKQYDAHLLEAQKWGTKLQMTIGIMVGGMMSIVFLNYGLGF
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00422811   1/2  ealselnsvlveslsgirtvkafgaeerelerfeealdelrkaslklarlsallspllqllsalalalvl
00420702   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00530601   1/2  laqealselnsllveslsgirtvkafgaeerelerfdealdellkaslklarlsallspllellsalala
00422142   2/2  ----------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00378842   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00360951   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00373851   1/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           WMGSRFIVSGETELANIITILLAIIIGSFSLGNVTPNAQAFTSAIAAGAKIFSTIDRKSPIDPTSEDGET
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424961   1/2  ------------------------------------------------------------lgepldglgp
00378982   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00422811   1/2  llgallvlngeltvgdlvafllyalqllgplsqlgsllselqrarvaaeRi..........DP-------
00420702   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00440861   1/2  -------------------------------------------------------------------Mpl
00475892   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00436511   1/2  --------------------------------------------ievpvglallgrvldllgepidgkgp
00468602   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00530601   1/2  lvlllgaylvlngeltvgdlvafllyalrllgplrqlgsllselqralaaaerifelld...P.EP.---
00422142   2/2  ----------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00498251   1/2  ---------------------------------------------------vekllglalllieklflkv
00426052   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00488521   1/2  -------------------------------------------------------------------lll
00532531   1/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00371631   1/2  -------------------------------------mseliiylelselewallradvgltlteaelkr
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00500611   1/2  -------------------------------------------------------------------pgl
00451571   1/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00464791   1/2  ---------------------lsvpvgdkllGrvldv.............lgepidglgpllalerl.pi
00414122   2/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00379261   1/2  ------------------------------------------------------------------drll
00513762   2/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00495771   1/2  -------------------------------------nellrpivanvdlvlivvdardplfslnlllry
00513252   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00392701   1/2  ---------------------------------------------------------------eklrpvl
00432182   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00420941   1/2  -----------------------------------------------------------------lrpvl
00482722   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00367291   1/2  --------------------------------------------------------------------vt
00480442   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00402371   1/2  ------------------------------------------------------vlektgipltkl....
00515352   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00418301   1/2  ---------------------------------------------------------------------d
00516042   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00521551   1/2  ---------------------------------------------------------------------p
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00378842   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00360951   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00373851   1/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  -------------------------------------------------------------Plsklledd
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LEKVEGNIEFRDIRHIYPSRPEVLVMKGVNLFVPAGKTTALVGPSGSGKSTVIGLLERFYNPVGGSVLVD
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  -------llllllallllllllllldpllelenlsksyggrl.vlalkdvsltvkpgeivalvGpnGsGK
00490802   2/2  ----------------------------------------------------------------------
00490801   1/2  -------llllllllalllelleeeeellllllalllllgdpllelenlsksy...ggvpalkdvsltik
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  -------lllllllllaeellelleeeelllllllllllllgdpllelenlsksy...ggvpalkdvslt
00379582   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  -----------llllelknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGe
00509431   1/2  -------Mlelknlslsnfr.....vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrl
00482202   2/2  ----------------------------------------------------------------------
00530591   1/2  -----------llllllaleelpllgelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKST
00379581   1/2  -------lepllevenlsksy...ggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGe
00458602   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00367901   1/2  -------lelknlslsyg....ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrl
00458601   1/2  -----------lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGei
00482261   1/2  -----------lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGei
00424961   1/2  lrpapgllelenvsksygtg...ialidlslpigkGervalvGpsGaGKttLlrliaglldpdsgeilld
00378982   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00422811   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00475991   1/2  -----------lllaaelpelgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkl
00475891   1/2  -----------lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkpt
00440861   1/2  lslgepllelenlsksy...ggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKS
00475892   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00378981   1/2  -------lpllelenlsksy...ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGei
00420701   1/2  -------lpllelenlsksyp.gggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGei
00422812   2/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00502741   1/2  --------lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilld
00502742   2/2  ----------------------------------------------------------------------
00390411   1/2  ------------MknlslrygnfralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgk
00404102   2/2  ----------------------------------------------------------------------
00500441   1/2  -----------lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkpt
00390412   2/2  ----------------------------------------------------------------------
00404101   1/2  --------elenlsksy...ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll.ptsGeilld
00466971   1/2  -----llalllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilld
00379601   1/2  -------llllpllllpdeplaaldvalqralvslerllellvdpgasdihinpggpvrvridgvlelll
00466972   2/2  ----------------------------------------------------------------------
00425571   1/2  -------lelenlsksy...ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilld
00468692   2/2  ----------------------------------------------------------------------
00466931   1/2  -------------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGeill
00436511   1/2  lelgepllevenlsksyggrklvlepletgialddvsltikkGervglvGpsGaGKtTLlkllagllkpd
00468602   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00436071   1/2  -------pllelenlsksygg....lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeil
00436072   2/2  ----------------------------------------------------------------------
00468601   1/2  ---------------------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlll
00361211   1/2  -------plellgepllelenlsksyg...gitalddvslgirkGeivllvGpsGsGKStllrnllagll
00485451   1/2  ------------------skiygd.ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagll
00468691   1/2  -------lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksygtg...ialid
00485931   1/2  ------------------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllv
00448932   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00422141   1/2  -------dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvli
00469451   1/2  -----allelenlskiyggvp..kalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeil
00368502   2/2  ----------------------------------------------------------------------
00448931   1/2  -------------------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllv
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ---------------------------------kpgevialvGpsGsGKSTlakllakelglefidsgdi
00372301   1/2  -------yvlPllsdgmpllelenlrkpy...ggllvlndvsl...pgeivaltGpnGaGKSTllrllag
00498251   1/2  lprllsllelenlskiy...tgipal.dvslglgGlppGeivlllGpsGsGKTtLalrllagllkpgggv
00426052   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00367481   1/2  -------yvrPelldepllelengrhPllsksyg...gkvvlndislsip.gellvitGPngsGKSTllr
00475372   2/2  ----------------------------------------------------------------------
00437981   1/2  ---lveklrpknldkvigqeeal...kdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgki
00475371   1/2  ------------------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlli
00437982   2/2  ----------------------------------------------------------------------
00368501   1/2  -kerllllelrnvllddviGqe.eakealsealelplkrpelfdglgvelpgknvlLvGppGvGKTtlar
00496111   1/2  -----------elenltklytgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvl
00488522   2/2  ----------------------------------------------------------------------
00488521   1/2  llalelllevenlristgike...ldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGei.
00532531   1/2  ----------------------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilid
00371632   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00495371   1/2  esalellleledltklstg...ikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkp...ev
00503371   1/2  ------------------------Mmlkslelknfkslkdvsligdfspg.ltaivGpNGsGKStlldai
00464792   2/2  ----------------------------------------------------------------------
00371631   1/2  lkglndlleledlskiygplsrlikllleellrllgklalddvslsvkkpeiigiaGpsGsGKSTlarlL
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381441   1/2  -----------------------------------GeliaivGpsGsGKsTLlklLagllppdsgsigsl
00451572   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00457311   1/2  ---------------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgviv
00480471   1/2  -----------------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettr
00500611   1/2  lsllelllelenltklp...tgipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapdsgeil
00451571   1/2  -------------------------------MsikkgeiiaivGppGsGKsTlaklLakll....glivl
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00495031   1/2  lsalellleledltkistg...ipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglglipl
00381442   2/2  ----------------------------------------------------------------------
00437941   1/2  lrplveklrpknlddvy...gqeevlkalslalekgrpehlllvGppGtGKTtlakalaglllptsggvr
00500612   2/2  ----------------------------------------------------------------------
00464791   1/2  erlappllelenlskrfgtgi...vlidvslpigkGervglvGpnGaGKTtLlkllagllkpdsgeivvy
00414122   2/2  ----------------------------------------------------------------------
00462761   1/2  -------------------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvv
00490731   1/2  ---------------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvlli
00414121   1/2  ---------------------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviep
00457312   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00475381   1/2  ---------------------------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvd
00475521   1/2  ---------------------evlalhgvsldve.gevvllvGpsGsGKStllralag.....sGeilvd
00478411   1/2  ---------------------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.....Gtill
00379962   2/2  ----------------------------------------------------------------------
00512891   1/2  ------------------------------------evilltGppGvGKTTlakalagelgakfgsvslt
00512892   2/2  ----------------------------------------------------------------------
00379961   1/2  -------yrpvdfddivGqee...alralslalaagppegvllvGppGtGKstlaralagllppdsgriv
00475382   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00368571   1/2  --------------------------llgvrllpplppklagllplagladgdglgvllGklldgvpvtl
00434401   1/2  -------------------------MlsksyggllalddvslsvkkgliigitGpsGsGKTTlaraLael
00387202   2/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavi
00533502   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00387201   1/2  mssgepllevenlskry...ggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvspt
00444382   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  -----------------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvl
00478441   1/2  ---------------------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl.....Gailv
00515531   1/2  ----------------------------------kgekvallGlsgsGKSTllnrllglefaygpTigpt
00489571   1/2  -----------rvknlsksyggktalddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt.......
00515532   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00513761   1/2  ------------------------------------kiiaivGkgGsGKTTllnklaglla.dggkvlvi
00477972   2/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------kGelivllGpsGaGKsTllkllagllgptsgvisvg
00470732   2/2  ----------------------------------------------------------------------
00379261   1/2  leelrp....vllddviGqeeak...ealsealrlplkrlelferlglrrpgknvlLvGppGvGKTtlar
00513762   2/2  ----------------------------------------------------------------------
00498811   1/2  --------------------------------kP.gkiigltGpsGsGKsTlarlLae.l....gvivid
00489572   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00464411   1/2  --------------------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvllt
00510561   1/2  -------------------------ldglgepldgllpilaklfrpievlalgllerksverlstGikaL
00444381   1/2  ------------------------asdelekllelrpvlledvigqeeakkalslalelplkrlelfgkl
00496572   2/2  ----------------------------------------------------------------------
00356411   1/2  ------------lknlsksygilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTigineg
00406782   2/2  ----------------------------------------------------------------------
00477971   1/2  ---------------------------------hkgelvvlvGPsGaGKsTLlnaLlgll.ptsgvisvs
00499191   1/2  -----------------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd.
00496571   1/2  -----------------------------------GkgelivllGpsGsGKsTlarlLagll...ggsvl
00503741   1/2  --------fifldlrplallplpdrlvgrdeeiealskalgg.....aldgvslsiepggivllvGppGv
00477012   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00487021   1/2  --------------------------------rm...kiivltGpsGsGKsTlarlLaell....gvvvi
00404192   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------arpltfddvvgqdeakeeleellagllgikkpkvil
00420942   2/2  ----------------------------------------------------------------------
00468951   1/2  --------------------------------lnvlgesidalgkilseilkllekgfltalgllerksv
00498531   1/2  --------------------------------ldklgkildlalkileksflklevlalgvlerkeverl
00405882   2/2  ----------------------------------------------------------------------
00439861   1/2  --------kleeveristgipeldellg..GglpkgslilitGppGsGKTtlalqlaanlaknggkvlyi
00532471   1/2  ----------------------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvd
00404191   1/2  -vellpkvtlddlvgleelkealkealellslgikpgeivllyGppGtGKTtlakalanelkkrggrvly
00498532   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigpt
00480251   1/2  ---------------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvll
00489631   1/2  -----------------------------------MkgklillvGppGsGKtTlaraLaellglpf..ir
00406781   1/2  ------------------------llkdlslgippgknvllvGppGtGKTtlakalagelgvpfvrisas
00495771   1/2  lvlaeaagippvlvlnKiDlleeeedlelleellkelesigvdvvlvsakk.galldilldilkgktval
00513252   2/2  ----------------------------------------------------------------------
00477011   1/2  -------------eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvggg.p
00489632   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00405881   1/2  -----------------------------------gervglvGrpgaGKSTLlnaltglkaivsgypgtt
00392701   1/2  lddvvgqeeakeallealaga.rlaledlslgirpgknvlLvGppGvGKTtlaralagllgapfgrvdas
00432182   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------iellsdlslsipspevvllvGppGsGKstlakklaell....gfilid
00533152   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00508671   1/2  --------------------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlara
00420941   1/2  lddvigqeeakeallealalplkrldlglslgirpgkgvllyGppGtGKTtlakalagel..........
00482722   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00432181   1/2  -----------------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgt
00437922   2/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00482721   1/2  -----------------------------------kgkiigltGpsGsGKsTlarlLae.l....glpvi
00367291   1/2  lddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanel..........
00480442   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00394721   1/2  lvslleslelplleklrpvllddvvgreealeallealrrgpprnvlLvGppGvGKTtlakalakelaag
00402371   1/2  .......lrpvllddviGqeealeallealrr.rpgrnvllvGppGvGKTtlaralagllvrssgpilld
00515352   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00437921   1/2  ------------------------alerlllalkagklphlllvGppGvGKTtlaralarlllgsgggvd
00473942   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00469161   1/2  ------------------------------------llIvieGppGsGKsTlaklLaerlgltglsvllt
00478082   2/2  ----------------------------------------------------------------------
00478081   1/2  -----------------------------------gkvivltGppGsGKtTlarlLaellkplgggvvvi
00496062   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00437901   1/2  --------------------------lflslgirpgrillLyGppGvGKTtlakalakel..........
00457852   2/2  ----------------------------------------------------------------------
00499331   1/2  -----------------------------PslslkkgklivltGppGsGKtTlakaLaerl....glpfi
00430122   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------lealkavllgirpgehllLvGppGtGKTtlaralagel..........
00472912   2/2  ----------------------------------------------------------------------
00527261   1/2  ------------------------npfilgpkvdledfigreeelkeleeal..pkivlltGprGsGKTt
00461621   1/2  ---------------------------------mkgmiialtGppGsGKsTlaklLaerl....glpfis
00418302   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00420081   1/2  -------------------------------smkkglrIaleGpsGvGKTTlaklLarhlgptggrvllv
00487061   1/2  ----------------------------------ldMkkgklIvieGppGsGKtTlakaLaer.gargld
00478392   2/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00472911   1/2  --------------------------------mkmkkgklilltGppGsGKtTlaraLaellgapfisgd
00418301   1/2  rplleklrpvllddviGqeeakkallealalplkrlelfeklrgirpgknvlLvGppGtGKTtlaralak
00516042   2/2  ----------------------------------------------------------------------
00511381   1/2  -----------------------------llllkpgglvlitGPtgsGKsttLlralnrleeagkgvilv
00517692   2/2  ----------------------------------------------------------------------
00416171   1/2  -------------diigqeeakkallealslaartgenvllvGppGtGKttlaralakllprsgvpfvrv
00480441   1/2  ------------------------------------rlivllGpsGaGKsTlaklLaell.p..glivis
00469162   2/2  ----------------------------------------------------------------------
00430121   1/2  -------------------------rkglelgirpggnvllvGPpGvGKTtlakalagllfp........
00473941   1/2  ------------------------vkkalllalalallrgepgehvlLvGppGtGKTtlaralagllga.
00516041   1/2  -----------------------------------mlkgklillvGppGsGKtTlaralaeel....glp
00521551   1/2  lveklrpvllddvigqeeakealleal.arlkapelflslglrpgkgvlLvGppGtGKTtlaralagll.
00496061   1/2  -----------------------------------gklivltGppGsGKtTlaklLaerl....glpvis
00409842   2/2  ----------------------------------------------------------------------
00509891   1/2  -----------------------------------pkvigitGpsGsGKTTlanaLarllkarglkvavi
00533151   1/2  -------------------------M...sldikkgklivltGppGsGKtTlarlLaerl....glpfis
00476071   1/2  -----------------------------------kgkiigltGpsGsGKsTlaklLaelglpvidtddl
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  -----------------------------------mngklivltGppGsGKtTlaraLaerl....glpv
00497572   2/2  ----------------------------------------------------------------------
00482661   1/2  --------------------------------kkvaivllsnyalsislddlllildlykevqvaydnfy
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478391   1/2  --------------------------------msikkgklilltGppGsGKtTlaralaerl....glpv
00497571   1/2  -------------------------aselvqwlldlgildeseilledlenalalllsligaklvkdlll
00478131   1/2  -----------------------------------kgkvivltGppGsGKtTlarlLaellkplglgvvv
00517691   1/2  ----------------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvd
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------kpkvilltGppGvGKttlarlLakll...glpliid
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgt
00501942   2/2  ----------------------------------------------------------------------
00483811   1/2  -----------------------------------PkvillsGpPGvGKTtlaaaLakyLksqgldvlvl
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00512061   1/2  ---------------------------------kkkkgklivltGppGsGKtTlakaLaerl...gglvv
00457851   1/2  ---------------------------------PkgklivltGppGsGKtTlakaLaerl....glpvis
00459701   1/2  ----------------------------------MpkvillvGppGsGKTTlakaLakrlgekgvkvvv-
00410322   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  --------------------------------everlstgipalDellgGglppgslvliaGppGsGKTt
00471272   2/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------mgklivllGpsGaGKsTlaklLaeklglivlsv---
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  -----------------------gelknlslelkkglkillvGlngvGKTtllkrlag............
00441252   2/2  ----------------------------------------------------------------------
00378842   2/2  ----------------------------------------------------------------------
00477561   1/2  -----------------------------------kkpkvillvGppGsGKtTlaraLakrlaelgkgvv
00477721   1/2  -----------------------------------kpklilltGppGsGKttlaraLaeel---------
00464592   2/2  ----------------------------------------------------------------------
00480501   1/2  -------------------------M.........gklillvGppGsGKtTlaralaell...ggvvvid
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  --------------------------------ipkknclllyGPpgtGKstlakalagllggtvlsvnns
00489391   1/2  --------------------------------lsikkgklivltGppGsGKtTlakaLaerl....glpv
00476652   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------apkli.ltGppGsGKttlakaLaeelg---------
00464421   1/2  ---------------------------------MkkgkfIvieGpdGsGKTTlaklLae.l.elgigvvv
00474202   2/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00360951   1/2  ------------------------------------kviavtsgkGGvGKTTtaanLaaalarlGkkVll
00410321   1/2  -------------------yggllllkdlslelkkglkilllGlngaGKTTllnrl--------------
00457881   1/2  ---------------------------------m.gklivltGppGsGKtTlaklLaerlg---------
00491901   1/2  ---------------------------------lmkgkiilltGppGsGKttlakaLaeel---------
00403152   2/2  ----------------------------------------------------------------------
00373851   1/2  ------------------rellllllllllllkgkpkviavtsgkGGvGKTTtaanLaaalaerGkkVll
00486891   1/2  ------------------------------------mlivltGppGsGKtTlakaLaerlg---------
00493981   1/2  -----------------------------------kpklilltGppGsGKttlaraLaeel---------
00463151   1/2  ------------------------------------MkiIgltGpiGsGKsTvaklLaekl....glpvi
00464591   1/2  ------------------------------------klivltGppGsGKtTlakaLaerlg---------
00495061   1/2  ------------------dlgllliyeevllydvvprgrlivlsGPsGaGKs.llk--------------
00501941   1/2  ------------------------------------klilltGppGsGKttlaralaeel....glpfid
00387322   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00503171   1/2  ---------------------------------psgrlivltGPsGsGKsltdtlskaLleelplkf---
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00518511   1/2  ------------------------------------klIvleGpsGsGKsTlaklLaeklg---------
00414002   2/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00486921   1/2  ------------------------------------mlivltGppGsGKtTlakaLaerl..........
00378621   1/2  --------------------glklllrrlslllkkglkvllvGlpgvGKstllnrl--------------
00515801   1/2  ------------------------------------llIvltGppGsGKtTlaklLaerlg---------
00401211   1/2  -------------------------------elkrglnvgivGhvgaGKSTLlnaLlgll..........
00471271   1/2  ------------------------prailelesliksllekllellkrlslklkkg--------------
00493061   1/2  ------------------------------------mlIvltGppGsGKtTlakaLaerlg---------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  --------------vwvpdeeeglvlalvlsdgslllvkldlllllnplkllgveDlalLsylneasvlh
00387941   1/2  -----------------------------------mkviavtsgkgGvGKTtlaanLaaalaerGkkVll
00503161   1/2  ---------------------------------pkgrpivLiGpsgsGKs.ladlladrlglp-------
00462581   1/2  --edleslllnplvkfedivpkvlddleealealaea.klpppkgvllyGppGtGKTtlaralakel...
00470231   1/2  -----------elaellsllierlllrdlllelkll.kvllvGdpnvGKStLlnrl.kivsdpgtTigvv
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  ------------------------------------deelelleklslllveklrpvllddlvgqeeake
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00387321   1/2  --------------------glkglllrlklelkkllkillvGlpgvGKTtllnrl--------------
00348321   1/2  ----------------------------ilealrsgrvvllvgptGsGKTtlalalalel...ggrvlv-
00523461   1/2  -----------------------------------a.kvalvGlpnvGKStLlnal--------------
00414001   1/2  --------------------------rrlllelkmllrvgivGlpNvGKSTLfnaLtgakvaivanypft
00488191   1/2  ------------------------fllsllrrlslllkrllkvalvGlpgvGKStL--------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  ------------------------------------yeplveklrpvllddlvgqeeakeallealaggr
00484261   1/2  ---------------------------------kkllkialvGhpnvGKStLlnrl--------------
00402381   1/2  lplllklrpdlfddvvgqdeaieallealrrarkglnlglkprgnvlLvGppGtGKTtlaralakal...
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------kglkivlvGdsgvGKTtLlnrl--------------
00378841   1/2  ----------------------------------kelkillvGdsgvGKstLl-----------------


                         *         -         -         -         -         +         -:560
query           GVDIQNLNLKWLRQQISLVSQEPTLFGTTIYNNIKQGLIGSPFELEPDQSVRQRIENAAKMANAHDFIMG
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  STllkllagllkptsGeilldgldilalslaelrrrigyvfqdpalfpltvrenlalgllla........
00490802   2/2  ----------------------------------------------------------------------
00490801   1/2  pGeivalvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll...
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  ikpGeivalvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll.
00379582   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  illdgkdilglslkelrgigyvvqqdallpsltvlenl.........llgllllgllllllaakeaalra
00509431   1/2  lragglsdliflgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdislldlr
00482202   2/2  ----------------------------------------------------------------------
00530591   1/2  llkllagllkptsGeilldgkditdlslkelrgigyvvqqdallpsltvlenl.........llgllllg
00379581   1/2  illdglditalslaelrrrgigyvfqdpalfpgltvrenlalgllllllll...lllllllllalskaea
00458602   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00367901   1/2  sglidlilkgllllprstvatvelifdllgllliirrlilrdgsgeilidgkdislldlrelrrligyvp
00458601   1/2  lldgkditglspqelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakeaalr
00482261   1/2  lldgkdildlslaelrgigyvfqqdallpsltvlenlllgllllgellll........llaakeaalral
00424961   1/2  gvdigersrevtelleelrrviglvfqdpplfprltvaenialga.............eyfrdegadvll
00378982   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00422811   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00475991   1/2  lagllkptsGeilldgkdildlslaelrgigyvfqqdallpsltvlenlllglllagelll........l
00475891   1/2  sGeilldgkdilglsllellrrgigyvfqdpalfpglt.............vlenlllgllllglalkea
00440861   1/2  tLlnaLlgllkpdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlvl
00475892   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00378981   1/2  lldgldllllslaelllllrrgigyvfqdpalfpgltvrenlalglllag.........lskaeaaaraa
00420701   1/2  lldgldllllslaellalrrgigyvfqdpalfpgltvrenlalglllag.........lskaeararale
00422812   2/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00502741   1/2  gkdilglslaelrgigyvfqqlallpsltvlenlalgll.........llglskaeaaaraaellell..
00502742   2/2  ----------------------------------------------------------------------
00390411   1/2  lsdlirrgadkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelll
00404102   2/2  ----------------------------------------------------------------------
00500441   1/2  sGeilldgkdildlsl..lrrgigyvfqdpalfpgltvlenlllgll.............llglslaeaa
00390412   2/2  ----------------------------------------------------------------------
00404101   1/2  gldltalslaelrrgigyvfqdpalfpgltvrenlalgll.................kaeararalelle
00466971   1/2  gkdilglslaelllllrrgigyvfqdpalfpgltvlenlllgl.........lllglllllaakeaalrl
00379601   1/2  vvldllsldleellalasriavlagrdiserrlpldgallpdgsrvrvrlsplptllggeslvirklpkl
00466972   2/2  ----------------------------------------------------------------------
00425571   1/2  gldllalsl..lrrrigyvfqdpalfpgltvrenlalgllll.........glskaeaaaralellell.
00468692   2/2  ----------------------------------------------------------------------
00466931   1/2  dgkdilalspeellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllllell
00436511   1/2  sGeilvdgligerlrevlelirelelaelrrrigyvfqdpalpallrllalfpaltvaenlrfgl.....
00468602   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00436071   1/2  ldgldlla.....lrrgigyvfqdpalfpgltvlenlalgllllgll..............ealaralel
00436072   2/2  ----------------------------------------------------------------------
00468601   1/2  gaDiyraaaae.rlgigavpqdvplfpsltvldnlala...............rdlleaakaagydvvli
00361211   1/2  aptggsvlldgleisalslaerlragigyvfqdlalfpeltvlenlalg.....................
00485451   1/2  kpllltggkvlvigldifrlsarelrkrig.vfqdpallphltvpenldlglll.........eilervl
00468691   1/2  vsltigrGervglvGpnGaGKttLlkllagllkpdsgeilvdGedlr..elrelrrrigyvfqdpalfpe
00485931   1/2  gadi.........rrigavpqlpvlfprltvlenlalg..........gadlaeraeellellglegfdv
00448932   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00422141   1/2  elifldeeellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklrevil
00469451   1/2  lldgkdvlylsleesleqlrrrigyvfqdpalfp..................................ae
00368502   2/2  ----------------------------------------------------------------------
00448931   1/2  gadiarla...areqlgivfqdp...gltvlenlalg............eleararellellgledydvv
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  lrdgvdlggesglllrdlrrliglvfqdpilfpgltvglllffldnidlgllirg.........deelea
00372301   1/2  lllpasggilvdgedlr..........igyvfq.....................................
00498251   1/2  vyidgeesldll...rarrlgvvlqelllfpeltveenl...............................
00426052   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00367481   1/2  alaglllpasggilvpgedalll..............................................r
00475372   2/2  ----------------------------------------------------------------------
00437981   1/2  lldgkdi........rrgiglvfqliglfphltvlelvalgl.....ggilveevrellkel........
00475371   1/2  gaDirrpsarellgllgell..................................................
00437982   2/2  ----------------------------------------------------------------------
00368501   1/2  alakllga..pfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpgtvlenlalgllvseli
00496111   1/2  iiglelsaeelrerrrrigyvfqepalfpeltvlenlalgll............................
00488522   2/2  ----------------------------------------------------------------------
00488521   1/2  ..............ggkvlyvdqeeslfpltvlenlalg..............gedveellerlgl.dll
00532531   1/2  ggdinleggfyakaigllrrkigyvfq..lfpfltvlenvalgld.....glvdeedleraenllalvgl
00371632   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00495371   1/2  lvdgldltglspa..rggiglvfqteallppltvrenlealgldlrglld......rerviellelvgle
00503371   1/2  agllgpdsgeirldgkdlliylsdlirrgagiayveqefdlfdgltvlenvllglgdeliirrrilrdgr
00464792   2/2  ----------------------------------------------------------------------
00371631   1/2  agllapesgglkvlligtDifylpa.eqlkrigllfqkglpealdveell....................
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381441   1/2  ttrlprlgevdgvdltfls....reeigyvfqepallpdltvlenlylglllalllaleegkivildgdr
00451572   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00457311   1/2  idgddlyklsreelrklrrrigmvfqdpalflnpgltvrenlaeplrllklgkk................
00480471   1/2  dfilgeilldgkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllgldllllellk
00500611   1/2  lggkvlyisleeslrrrrigmvfqelgldpdltv...................arerviellelvgllel
00451571   1/2  dgddl.......lreaiglvtqdgelllelide..........gilvpdeiviellrealeeldadgvil
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00495031   1/2  ggkvlyigleltlsperlrlraqsl...................................gldldeller
00381442   2/2  ----------------------------------------------------------------------
00437941   1/2  vlgidaselld...........................................................
00500612   2/2  ----------------------------------------------------------------------
00464791   1/2  g..ligerprevrellglllelgvlf.........................................aae
00414122   2/2  ----------------------------------------------------------------------
00462761   1/2  lldgddlr......lglliglvfqdpdllpfltvlenvllpllaagliv........ivdgtlllvglre
00490731   1/2  daDpyrpaadellgvlaee...................................................
00414121   1/2  dfgeilidgqlledlgvlavrlgigyvpqtlglfpaltvlellalall......................
00457312   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00475381   1/2  glrlavlsrdllgllreglirigyvfqdyalfprltvlenvllgll........................
00475521   1/2  g.dlv..dleplrrdigmvfqdpalfplltvrenvilg.llelagl.skaealarvdellelvglddell
00478411   1/2  dg.dlvrlglkd...gigmvfqdpalfplltvrengvalglllag..........lskaeieervdllle
00379962   2/2  ----------------------------------------------------------------------
00512891   1/2  grdv.....rsarrgigyvfq.......tveellgllaelvgle..........................
00512892   2/2  ----------------------------------------------------------------------
00379961   1/2  lvgnlsdlldpkdlrellragiplvflnfaalpasllesel.............................
00475382   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00368571   1/2  dlgelgrhllivGptGsGKStllrllaglllpdggrviviDpkgeyaglarglgvvildpgdgrsvrlnp
00434401   1/2  lrerggsvavidlddfyrpaaelllreglgidfqlpdal...............................
00387202   2/2  ----------------------------------------------------------------------
00484101   1/2  gldigrldldellgigylfqdvgllpvltvrenlal......llrglpgysaeeleralellelagfdvi
00533502   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00387201   1/2  ftlvreyelGeilldgrdlyrlsleeallllfldeileidglllvelregigyvfqdpalfpel------
00444382   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ldgepigtp....lgrgigyvfqdpalfpgltvrenlelll........vfadrygvlrglikpalaegv
00478441   1/2  dd.dlvll..elrgrdilmvfqppalfpllevrglniaevlelagl...skaealkrvdlvlelvgld..
00515531   1/2  sgtieidgvklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltv
00489571   1/2  ......................................................................
00515532   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00513761   1/2  dlDparanlpeqlgi.............dirdlidletvme.lglgpngalvfaleellttldilleale
00477972   2/2  ----------------------------------------------------------------------
00493431   1/2  gttreprpgev..rgigyvfqsgalfphl....ivagnllegaevh..gllygtskerveeale....kg
00470732   2/2  ----------------------------------------------------------------------
00379261   1/2  alAkllga..pfvevdaselteggyvgedlekrirelfqearllvfltvlenirldaseylekrvvsrli
00513762   2/2  ----------------------------------------------------------------------
00498811   1/2  gddltrelvaggglliglifqdfglfelldrellielllenlalglalegvilda...lrrrllelldll
00489572   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00464411   1/2  gepvsgeplge...ligevfqdgilfpdltvlenvalgrygll..glikealaegvivildrvglsdlay
00510561   1/2  DlllgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleql..rarrlgldldrll
00444381   1/2  ddligrspairrllellgarpgenvlLvGppGtGKTtlakalakllgv..pfiridgselte...kelvG
00496572   2/2  ----------------------------------------------------------------------
00356411   1/2  tieidgvkltlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnlt
00406782   2/2  ----------------------------------------------------------------------
00477971   1/2  gttrp..prpgevdgvgyvfqsrelfpeltvagnfleg........................aevrgnly
00499191   1/2  .............gllvgvvfqddfylllpalevlengaflldlllpdal..........drelllelll
00496571   1/2  dtgepirgeplgelir..glvfqdpllldel.......................tvlenlalgrylhlgl
00503741   1/2  GKTtLakllagllkpkfgeillfg..............................................
00477012   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00487021   1/2  dtddllra.............................gevfqdyalfphltvlelldnvllgleirgllk
00404192   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00470731   1/2  lvGppGsGKTTlaralakel..gagfilidgddlrekavgeleklgrdlfqvaregglvpdilfideida
00420942   2/2  ----------------------------------------------------------------------
00468951   1/2  erlstgikaLDlllgiGglprGelvlivGppGsGKTtlalqlaanla.klggkvlyidteesldqlr..a
00498531   1/2  stGikaLDallgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleql..rarrlg
00405882   2/2  ----------------------------------------------------------------------
00439861   1/2  sleesreqlleraerlgldleellllgllsiliad...................................
00532471   1/2  dlgrdvgelggaalldivd.................egrliglvfqdldllpllevlellaa........
00404191   1/2  vsa...................................................................
00498532   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00515511   1/2  egtieidgvklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllv
00480251   1/2  idlDpyrpsapeqlgilgellg..............vpvvgvltgldlagalrealell...........
00489631   1/2  idgddllrellgel.lgrgigfgfqqgdlledatvlenlalllldeidka....................
00406781   1/2  e.....................................................................
00495771   1/2  vGpsGvGKStLlNaLlgellattgeipgdggdgrhtTrdvllirle....glvliDtpGfrdtileniek
00513252   2/2  ----------------------------------------------------------------------
00477011   1/2  gtrrptelrlsetpgltvlvvflelgerldl......lglvfqdfsllpeliel......enralagpia
00489632   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00405881   1/2  ldpnlgvveldd...............................grqlvlvDtpGlielaslgeglvrqal
00392701   1/2  d.....................................................................
00432182   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00513251   1/2  addlr.................................................................
00533152   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00508671   1/2  LakrLeepgsgvvlldgddlraglsiglilsdedraalrrrlgevfqelllagrlvvldgtalglel...
00420941   1/2  gapfiridg.............................................................
00482722   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00432181   1/2  trdptlgvveldgrkl......................................................
00437922   2/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00482721   1/2  dtddlyrelvaggtplgerirellgegyllpdealfrallaellfgdllalalldgvv............
00367291   1/2  gapfirvda.............................................................
00480442   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00394721   1/2  sgpilldgvpvvrldlsellsv................................................
00402371   1/2  gvpfvrldaselle........................................................
00515352   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00437921   1/2  vieldasdl..rgvddlreligevlqalglllgg....................................
00473942   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00469161   1/2  redgfgtplgelirelllegfqdlilvpdllv.............................lellaanra
00478082   2/2  ----------------------------------------------------------------------
00478081   1/2  ..dtddlrreairelllgldlleilf............................................
00496062   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00437901   1/2  gapvieidaselrd........................................................
00457852   2/2  ----------------------------------------------------------------------
00499331   1/2  dtddllrepvigagtdigevfqdlllaggllvddev.............................rrlll
00430122   2/2  ----------------------------------------------------------------------
00386741   1/2  gapfvrlda.............................................................
00472912   2/2  ----------------------------------------------------------------------
00527261   1/2  llkalakelg..kpviyidlselsskgyvdleellrela...............................
00461621   1/2  tddly.......revvergtelg..........klikdyfdpgalvpdllirlllerllfldegggflld
00418302   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00420081   1/2  gEPiaywrsvggsdlleliyqlplrldlgeislddaallllslqllfaapylslnevidaarvlladefi
00487061   1/2  vvviyepvdywaavgggdllr......................lirelllrlgfgepdafdn.ellgell
00478392   2/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00472911   1/2  dllrglageggkpl........................................................
00418301   1/2  llgr..................................................................
00516042   2/2  ----------------------------------------------------------------------
00511381   1/2  kdaidtrlgielvvsriglvleavglffaldllelll.................................
00517692   2/2  ----------------------------------------------------------------------
00416171   1/2  ncsalte...............................................................
00480441   1/2  vgdttrepregevlgvdyvfvdrelfeelivagnlled........................aivhglly
00469162   2/2  ----------------------------------------------------------------------
00430121   1/2  ......sgvpfirinlseltekllvselig........................................
00473941   1/2  ......................................................................
00516041   1/2  fvvidaddl..lrgeelgriielfdearelvpelallfideidell........................
00521551   1/2  .........gapfvrlsas...................................................
00496061   1/2  tddllreevepggtdlgeifqalllagellfddevlgll............rerldelielllaggvvil
00409842   2/2  ----------------------------------------------------------------------
00509891   1/2  drdpgrld........................................................ldeplg
00533151   1/2  tddllrelv.pggldigevfqdaleaglllfddefrglller............................
00476071   1/2  tregvll.......................................ggpllerirellgegyllfdeald
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  ...istddllreavpggtdigelfqdyllfpfltvdeni.................rglllealeellaa
00497572   2/2  ----------------------------------------------------------------------
00482661   1/2  kvdesdiayqyallakedenaaaflksnrqkklvrdladrviaeerlellekiieellrirldklledld
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478391   1/2  idgddllrelvgeggrlgrdlfdedrllfrellideidl...............................
00497571   1/2  lvlkylpsllslldvlrpkvdfddiileeakeelllellelplklpelfkrlglkapkrrgvlLyGppGt
00478131   1/2  i---------------------------------------------------------------------
00517691   1/2  g............................................................gtlllllgl
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00519581   1/2  ldalaell....fgdvgglvvdli..............................................
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  trdpilgv..............................................................
00501942   2/2  ----------------------------------------------------------------------
00483811   1/2  dldellrgllgqpklydlle..................................................
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00512061   1/2  idtddllrea........................gkirelfgflgelvfralelgllldeiekllakgkv
00457851   1/2  tddllreavpg.gtrlgeviqdlfllggllffdeldel............lkerieellaag...gvild
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  lalqlaanaalplelgklggkvlyistee.afsperlreralsl............gldleelldrllvi
00471272   2/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  ....................gefvdygptigvnfktvevdg.vkl.........................
00441252   2/2  ----------------------------------------------------------------------
00378842   2/2  ----------------------------------------------------------------------
00477561   1/2  vidt------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00480501   1/2  gddlrralvggl..........................................................
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  nl......nfwladlidk....................................................
00489391   1/2  istd------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  trEP------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00360951   1/2  idlDpqgpltdlllgl------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00373851   1/2  vdaDp.qas-------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  dtgDilrkalyratglgalakiisli.ellilfgelvpddlvldrlvlerlvf.................
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  addllrelv.............................................................
00387322   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00486921   1/2  .........glpfistddllreavpggtd.........lgelfqelllegellfrdell.....dlllev
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ......................................................................
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  nLklRylkdliYTyiG------------------------------------------------------
00387941   1/2  idaDpqgps-------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  .......glpfvrinasd....................................................
00470231   1/2  gtvel-----------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  allealragrpghvllvGppGtGKTtlaralanelprslpglpfvrvnasdltd..vglleellgkllga
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  Tldpn-----------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  pprpvllvGppGtGKTtlaralanelgrpfvpvallcfvrvncaallelsasdll...............
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  .......gvpfvrinlselteallvsdliGhldg.yv.................................
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           LPEKYETHVGERGFLLSGGQKQRIAIARAIVSDPKILLLDEATSALDTKSEGVVQAALDEASKGRTTIII
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  llllglskaeararalellellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpe
00490802   2/2  ----------------------------------------------------------------------
00490801   1/2  ....................lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldp
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  ......................lllaakeaalraellllllgletlldrrpseLSgGqrqRvalAralll
00379582   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  lllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelakglt
00509431   1/2  elrrligyvpqdpnllfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkelee
00482202   2/2  ----------------------------------------------------------------------
00530591   1/2  llllllaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetr
00379581   1/2  rervlellelvgldtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrela
00458602   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00367901   1/2  qdpalfpqltvlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeiee
00458601   1/2  alllllllgledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakeg
00482261   1/2  llllllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakgltv
00424961   1/2  ladsllrlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlveggsdpdllll
00378982   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00422811   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00475991   1/2  llaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraell
00475891   1/2  alralllllllgletlldrlvseLSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrela
00440861   1/2  lviddglteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdpnlf
00475892   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00378981   1/2  ellell.gldd....lldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrela
00420701   1/2  llell.gldd....lldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelak
00422812   2/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00502741   1/2  ...gledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvll
00502742   2/2  ----------------------------------------------------------------------
00390411   1/2  nllrrrgiglvpqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelarl
00404102   2/2  ----------------------------------------------------------------------
00500441   1/2  eralelllllgledlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelak
00390412   2/2  ----------------------------------------------------------------------
00404101   1/2  llgld..elldrlvgeLSgGqrqrvalarallllleelsldpdllllDEPtsglDpetraellellrela
00466971   1/2  ellllllgletlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakegl
00379601   1/2  iltledllelenlsfsy...ggkealkdlslaiepgelvlivGptGsGKTTllkallgllppdegiitie
00466972   2/2  ----------------------------------------------------------------------
00425571   1/2  gldd....lldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltv
00468692   2/2  ----------------------------------------------------------------------
00466931   1/2  allldlllllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllglgdll
00436511   1/2  ....glavlllldsatrlaqakreisalarellervglpgdlftllsrlderagnlSgGqrqrvaiaral
00468602   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00436071   1/2  lellglgdl...drlvseLSgGqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgl
00436072   2/2  ----------------------------------------------------------------------
00468601   1/2  dtaglld..ldrlvgelsggqkqrvaiarala.apevllldeptsgldalae..llelleel..gltvlv
00361211   1/2  ....rarellerlglail...drlpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetv
00485451   1/2  ellel.......vgldv...vlldtyphelSgGqrqRvaiaralaldpdvlllDEptsglDpetralell
00468691   1/2  ltvlenlalgallag..............................lglaeyldelgkdLSgGqrqrvalA
00485931   1/2  vliDtag..rgrrvgelsggqkqrvaiarallllldpelllldEptsglda..lrlllellkel..gltv
00448932   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00422141   1/2  tledlglsy...gdpealkdlslaippgglvlltGptGsGKtTllralagllnpdegriltiedp.....
00469451   1/2  ellelvgledlldrlpge....lSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlL
00368502   2/2  ----------------------------------------------------------------------
00448931   1/2  liDt..agrlrlpselsggqkqrvaiaralaaplppevllldeptsglda..lrellellrel..gltvl
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  alelaglprvielllegldtlaggggvvlsGgqrqrvalar.....pdlllfldeptselleRllkrltr
00372301   1/2  ......llervgledlldrlpst....lsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeal
00498251   1/2  ..............drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarellellrrllrla
00426052   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00367481   1/2  vdeiltrvglsdlldrgl...........s.lsggerqrvalaralatdpslllLDEptsgldpedgaal
00475372   2/2  ----------------------------------------------------------------------
00437981   1/2  ...................lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelakgvt
00475371   1/2  ...gldvlvgarggdlsgglrqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgl
00437982   2/2  ----------------------------------------------------------------------
00368501   1/2  gappgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallgggrelrdgellka
00496111   1/2  ........drlpgeld..lSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrl
00488522   2/2  ----------------------------------------------------------------------
00488521   1/2  drlph...........qlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrel
00532531   1/2  eeipnrypse...........lsgGqqqrv...........illldEPtsgLdpvsr.............
00371632   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00495371   1/2  elldrlpre...........lsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlake
00503371   1/2  seyllnglgvs...lkeliellldlsggelnrvalllqgevdlllldepterldfldelagleeykgnye
00464792   2/2  ----------------------------------------------------------------------
00371631   1/2  ...........ellldlkegledilvp...vlsggqkqrlalaralvedpdvlilDgptalldpltr.el
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381441   1/2  eraeellellgldadlviilpasleellerldrrggelsggqkqRvalarallldpdllllD--------
00451572   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00457311   1/2  ..llepvglpevldryphe....lsgGqrQRv...ralaldpdllilDeptsalgqpdpelrelldllif
00480471   1/2  elkydpvilllnkidllddrllrraeaeerieellelvglsallgqn-----------------------
00500611   1/2  ldrlpre...........lkrsggqrqrvviDaralllrpel..lDEptsaldvslraeilrlLkrlake
00451571   1/2  dg...fprllgqaelllsggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiarallkkpai
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00495031   1/2  llvidllelvgllelldrlpre....lsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlL
00381442   2/2  ----------------------------------------------------------------------
00437941   1/2  ..............pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpkgvtvi
00500612   2/2  ----------------------------------------------------------------------
00464791   1/2  llervglvaatadeppgelsggqrqrlaiAraladdqgkpvllllDEptsgldal.reillllgellsee
00414122   2/2  ----------------------------------------------------------------------
00462761   1/2  alrkll..........gl.lsgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleere
00490731   1/2  ..lgldvllgarggdlsgglrqr..larallgdydvliiDtp.gtldvllelallellkellaelgadvv
00414121   1/2  .........lredpdlilid.....sgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldll
00457312   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00475381   1/2  ..............llgglvvildggvrqrlalarallldpdvllldepll-------------------
00475521   1/2  ldrlp..............sggqqqeilrvaiallilpvllgralallpelllldeptsaldpdlveeil
00478411   1/2  lvglddlldrypde....lsggqrqrvaiaralalepelllldeptsaldplavvellelllglnee.ld
00379962   2/2  ----------------------------------------------------------------------
00512891   1/2  vrgeleellktlikelsggekqrvalarallakpdvlllDEid.gldpdvleallelleelkrsgvtvil
00512892   2/2  ----------------------------------------------------------------------
00379961   1/2  ..........................lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevq
00475382   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00368571   1/2  laliddeedaaellralvsemgrgeddfftpaarallralilalae..........epeptldellells
00434401   1/2  ..drellreevlellgl.gevvivdvydlsggerqr...aralasgpdvlilDgptlgldv.........
00387202   2/2  ----------------------------------------------------------------------
00484101   1/2  lieGllelalplilelrelsdgqiqrvaparallrdpllllldedtvvl---------------------
00533502   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  svildrvglsdlaydgfprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelreldse
00478441   1/2  ............drypyelsggerqrvailr..vllpklllpdepgrnldvlievavlnlilkllgidal
00515531   1/2  lenlanvpillvlnKiDlleakeraeellellglgdlldklpse..............lsgGqkqrva--
00489571   1/2  ...................lallelrntteagaasgsrdkgllgklkpetraelldllre..egttilvv
00515532   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00513761   1/2  lleedydyiliD....tpGglelrallalllaiaralaadeillvddptsgldaetqleilelllelllk
00477972   2/2  ----------------------------------------------------------------------
00493431   1/2  llvlldr...........dlsggqqlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlle
00470732   2/2  ----------------------------------------------------------------------
00379261   1/2  gappgyvgyglggllteavrrlpysvllldelekahrpirvlllsaslvlllgglglpevgelllelldd
00513762   2/2  ----------------------------------------------------------------------
00498811   1/2  ...........gldvvilegplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylel
00489572   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00464411   1/2  ............pgf.lsggeqqrvaiarallpkpdlvllldepteeldeRllkRg....rllek.leyi
00510561   1/2  lld...altv.........................................eellalaerllsggkvdlv
00444381   1/2  e..................................................................seg
00496572   2/2  ----------------------------------------------------------------------
00356411   1/2  vlenvpiilvlNKiDlleekiveellellgleykgdrdpee...............lsggqkqrvalara
00406782   2/2  ----------------------------------------------------------------------
00477971   1/2  gtsrerveelleagldvlldidpqglsggqkqrlalaralilppsllrgldep.ealdarle.raleell
00499191   1/2  alveglvvlldryprllsggqrqrvaia.....dpdvlildgptllldpe....................
00496571   1/2  ilaalaagvgvvldrvglsdlaygfprtlsglgqrqrvalarallkpdlvifldeppteeldeRlrkrl.
00503741   1/2  ....kvvyvnvselldlkellrlllealglpppyq...lsggerlrvalaeallalgkpdllilDEitnl
00477012   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00487021   1/2  aerlervevllervgllldrippalsgGqgqrvildrallselayqpdvllldeplsgldaklreelrdl
00404192   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00470731   1/2  llrkgpdvildgagrtpeqlealldllee.................lgrpvvviilttnrevlldral.r
00420942   2/2  ----------------------------------------------------------------------
00468951   1/2  rrlgldlddllllpaltveellala.............................................
00498531   1/2  ldldellllpaltveellala.............................................erll
00405882   2/2  ----------------------------------------------------------------------
00439861   1/2  ............plglsgeellrvllalalelkpdlliiDeltalldaervrelrellralkrlakelgv
00532471   1/2  .....rleellerippalsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslllv
00404191   1/2  ..........delvsklsgglqeqrvaiafalarkpdllllDEidalgldpelqeellelldelaergvt
00498532   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00515511   1/2  lenlanvpillvlnKiDlleaklvllllvglfdll.................dglpselsggqkq-----
00480251   1/2  ........llegydvvliDtagglqrglllalaladlllvllldepllvldatagtellelakgllealg
00489631   1/2  .............ledggvvlldgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrtee
00406781   1/2  .......llgkyvgelsgglrqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrl
00495771   1/2  eeleatfe--------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00477011   1/2  gisrdairleielpglpdltlvDtPGlgsvavvdqlsggqkqrvalarallknpdtlillvedandldte
00489632   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00405881   1/2  ealeradvillvvdasdplldqpvellsggekqrlalarallgkpvilvlNKiDeptneldlellellee
00392701   1/2  .......llgkyvgelsgglrqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrl
00432182   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00513251   1/2  ..................gqkqrvalleaalkegylvvvDet..gldraqrlellelardlgrpvlvifl
00533152   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00508671   1/2  ........rdelrellkeaglpllvvfldaplevlleRdrrglypeelsgglkqrvaiarplelaaep--
00420941   1/2  .....sellgkyvgelsgglrqllalara..akpsilllDEidklapkrsptsaldadvrrevlnaLlrl
00482722   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00432181   1/2  ................vliDtpGleefasggekqrvalalallreadvlllvvdadeptsfldle...ll
00437922   2/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00482721   1/2  ..........ydrlrdellaelsggqgdvliiegalllepgllplpdlvifldappevlleRllkRg..g
00367291   1/2  .....selle..klvgegegrlrgalaealradpgvlflDEidalagkrgsgtsrldpevqnaLlrllee
00480442   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00394721   1/2  ................sdlvgelegglrgllteala.lakpsvlflDEidrlldardsesslevlnaLlr
00402371   1/2  ........fgkyvgafegglrqllglaraa..kpgvlflDEidsllgarggsgvdpevqnaLlrlleegn
00515352   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00437921   1/2  .....................................kpdvlllDEi.drldpdaqnallklleelpagv
00473942   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00469161   1/2  glrelikellaagkgvildrfplsrlayqlsggerqrlaidlegalllerllldep..............
00478082   2/2  ----------------------------------------------------------------------
00478081   1/2  ...........eglllsdefrelleealalladgdvvilDgfgrlldarq......lleelllllleepp
00496062   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00437901   1/2  .vddlsgyvge....lsggeklrellaealteavlkgkpsvlllDEi.daldpdvlnallklldglrdls
00457852   2/2  ----------------------------------------------------------------------
00499331   1/2  ealdell.laggkvvildgfpggllqrealrrllprpdlvilldappeelleRllkrgrldgreddslel
00430122   2/2  ----------------------------------------------------------------------
00386741   1/2  .............selsggeklrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivgggl
00472912   2/2  ----------------------------------------------------------------------
00527261   1/2  eelgellellkkllkklsellglsilgleli....lglsggdleelleelaellkklgkpvililDEiqs
00461621   1/2  gfp..rtleqaealskpavlsggrkqrlalaralavdpe.lild--------------------------
00418302   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00420081   1/2  kplpagykvvii----------------------------------------------------------
00487061   1/2  ealleg....................gkivlsarraqlleirlirpllaegkvvilDrepdsadlafaga
00478392   2/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00472911   1/2  ............gllfedaleagfrqrladlirallakgkvvild..gtglsreareellellkelg.pv
00418301   1/2  ......pfirvdaselte..aelvGy..esgarlrelfaragigllaladpgvlflDEidkllpargssg
00516042   2/2  ----------------------------------------------------------------------
00511381   1/2  .................................qdpdviliDE.aqfldp...evvevlleladtgilvl
00517692   2/2  ----------------------------------------------------------------------
00416171   1/2  .dlleselfghekgafgggekqrlgllrla..dggvlflDEidkl.....dpdvqnaLlrvleegeltrl
00480441   1/2  gtskerieealdaglgvlldgfprglsqaqalrlaldlvllldpslevlleRllgrgddteevirkrler
00469162   2/2  ----------------------------------------------------------------------
00430121   1/2  ............hppg..yvGedelgvlfeaarkappsvlllDEidkl....dpdvlnaLlqlleegevt
00473941   1/2  .pfielsasdllg......esdlrggfkqa........akpgvlflDEidrl.drevqnaLlelleelqv
00516041   1/2  ................akgkvvildgtgrlleldealell------------------------------
00521551   1/2  ...............elvgkyvgelegglrqllalaraa..npgvlflDEidklapkrsptsglddvsrr
00496061   1/2  dgf..........pldlegalllrealarallpdl.vifldapleelleRllkrgrllereddseevlek
00409842   2/2  ----------------------------------------------------------------------
00509891   1/2  vdrerlrrvgelalllaggglcalvaddlagaleel.laralaggpdviliE......gagl.lplplie
00533151   1/2  ....leellargpvvildgfpggllqrealrrlllrpdlvifldapleelleRllkr.............
00476071   1/2  rellaallfglel.egalldglvygvlqdrllerllaagpdvlildgpl.lldvellplpdlvifldapp
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  gkvvild..............glsggllqrvallrallrpdlvifldapleelleRllkR..ddseeeil
00497572   2/2  ----------------------------------------------------------------------
00482661   1/2  eiveelppvlfddlvgqeeakeallenlklflkgpellldlglpkgrgllLyGPpGtGKTtlakalanel
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478391   1/2  ................................llakgkvvildgtn.....lsealdealrrllr.....
00497571   1/2  GKTllakalakelgrl.pfirvn...............................................
00478131   1/2  ----------------------------------------------------------------------
00517691   1/2  lsfllalvldslplerergitidvalarllldgrkilllDtP.Ghed.....................fv
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00519581   1/2  ..............dleaverhlldiaeellengeilildeptvgldskd--------------------
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  ............................vlldgrdllllDtPGlidfaseptnlldleiieallrale..
00501942   2/2  ----------------------------------------------------------------------
00483811   1/2  .............ellellldegekipveliiellkdvlvsdpdviilDelpgtnlklqdletlssvakt
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00457851   1/2  ..........gfpldlegaealreallragplpdlvifldapleell-----------------------
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  dat......................dlldllellerlrrllsegkvdlvviDslallarael..ldepll
00471272   2/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  ...........viwDtaGqerfrsllarylrgadgillvvdatdglsfeevaklleellglaglegvpii
00441252   2/2  ----------------------------------------------------------------------
00378842   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00480501   1/2  .idgllilfledeaalselvlevllealegggnpdvvildgt----------------------------
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  ..................................kvvlldEadstcwdyivellknlldGdpvsvdvKhk
00489391   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00360951   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00373851   1/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  ...............sdpeevildgphplvqaeild.eiaralsvvldllvldeplvglqrrlagrrgiv
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  ..................gesirelfeaagrlaprellldeidellekg.givildgfllt.........
00387322   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00486921   1/2  ieellaag.gvildgfplslegaqalrallrelgldpdlvifldappevlleRllkrgrpddseeei.le
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ........ldtlkgelergitikigaasllldklaivsdtpgttldpilgvleldgpkllllDtPGhed.
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  .............llvgllvgelegrlrglfteav..lanpg----------------------------
00470231   1/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  at....................................................................
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  ...................................................eselfgeekea....flga
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  ...........................gededgiltgalrkapggvlflDEidkl...------------
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           AHRLSTIKTADNIVVLVDGRIVEQGTHDELVERDGTYLRLVEAQRINEERDAQAMADSDDGEESPMGSDA
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  traellellrelakgltvllvthdlslaa-----------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00490801   1/2  dlllLDEPtsgLDpetraellellrelakegktvllvtHdlsealladrilvlddGriveegtpeel---
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  dpdllllDEPtsgLDpetraellellrelakegktvllvtHdlsealladrilvlddGriveegtpee--
00379582   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  vllvthdlsearladrilvlddGrivelgtpeellenpgllytllll-----------------------
00509431   1/2  eleligplldglellvglnglldrplselSgGekqrlalaral---------------------------
00482202   2/2  ----------------------------------------------------------------------
00530591   1/2  aellellrelakgltvllvtHdlsealladrilvlddGriveegtp------------------------
00379581   1/2  kegltvllvthdldealrladrilvlddGrivelgtpeellenpgll-----------------------
00458602   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00367901   1/2  raeellellglgglldrpvstLSgGekqr-----------------------------------------
00458601   1/2  ltvllvtHdldealrladrilvlddGriveegtpeellenplllytllllga------------------
00482261   1/2  llvthdlsealladrilvlddGrivelgtpeellenpgllytllllss----------------------
00424961   1/2  DeptsalDgeivlslllalkrlyPaidvll----------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00422811   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00475991   1/2  ellrelakegltvllvtHdlsealrladrilvlddGriveegt---------------------------
00475891   1/2  kegltvllvthdldealrladrilvlddGrivelgtpeellenp--------------------------
00440861   1/2  pglvvlisaltgegldeltvrenlalglrlrg........------------------------------
00475892   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00378981   1/2  kelgltvllvthdlsealrladrilvlddGriv-------------------------------------
00420701   1/2  elgltvllvthdlsealrladrilvlddGrivel------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00502741   1/2  vthdldealrladrilvlddGrivelgtpeellenpgllytllllgsl----------------------
00502742   2/2  ----------------------------------------------------------------------
00390411   1/2  lelleglkeeaekakalleelkele---------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00500441   1/2  elgltvllvthdlsealrladrilvlddGrive-------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00404101   1/2  kegltvllvthdldealrladrilvlddGrivelgtpeelle----------------------------
00466971   1/2  tvllvthdldealrladrilvlddGrivel----------------------------------------
00379601   1/2  gpdel......lrnkigyvfQdpvlfpltvren-------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00425571   1/2  llvthdlsealaladrilvlddGrivelgtpee-------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00466931   1/2  drpvstLSGGerqrvalaralalalllls-----------------------------------------
00436511   1/2  asdpdllilDEp----------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00436071   1/2  tvllvthdldlalaladr----------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00468601   1/2  vtKlDgtakgghdlslalrladrilvlgvGeivedgtpfe------------------------------
00361211   1/2  aellellkelakelgvtvilvthdldlldsa---------------------------------------
00485451   1/2  dllrtdldkelgrtiilvthdlreae.adrilv-------------------------------------
00468691   1/2  r.....pvlLllDEptsgldalre..ilellrellkelgytvllvth-----------------------
00485931   1/2  lvvthddgtakggaalslaleladrilvlgdGeivedgt-------------------------------
00448932   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00422141   1/2  .......ieyvfqspnlfpl..........----------------------------------------
00469451   1/2  kelakelgvtvilvtH.......Asdrvlvlrdgrive--------------------------------
00368502   2/2  ----------------------------------------------------------------------
00448931   1/2  vvthlDllakggadlslaleladrilvlgdGeivedgtpe------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  pgldadteeellellerlare-------------------------------------------------
00372301   1/2  lellaelgatvlfvtHdlelaalladrvvvln--------------------------------------
00498251   1/2  kelgvtvllvthdldeaealadrvlvlaggrilehg----------------------------------
00426052   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00367481   1/2  aeallellaellgatvlvvtHdlelaalaad---------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00437981   1/2  vilathdlsellpallsrcqvirfpplseeelleildri-------------------------------
00475371   1/2  lvvdathdldavlkaadrilvldlggivlnkld..lvakggaalel------------------------
00437982   2/2  ----------------------------------------------------------------------
00368501   1/2  lkeaeaeelle..llglkdlllrkpsqlSgGqkqRvalaralla--------------------------
00496111   1/2  kelgvtvilvthdleeaedladsgriavl-----------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00488521   1/2  lrlLkrlakelgvtvllvthdldevarladrvl-------------------------------------
00532531   1/2  ............leladriyvllsGrivesgt--------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00495371   1/2  lgvtvllvthdleeveeladrvavlaggriveq-------------------------------------
00503371   1/2  ellklleeleellkelekrlellekeleelee--------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00371631   1/2  lellkelrdlldltilvdadlevlleRr------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00457311   1/2  ldadlgltlirlitrdlgeagrsadrvl..----------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00500611   1/2  lgvtvllvthdlreveeladkrdrvvvlrggri-------------------------------------
00451571   1/2  lil-------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00495031   1/2  krlakelgvtvilvthdlrevegrleladrvvv-------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00437941   1/2  lttnrleeldpallsRfdviefpppdeeelleilkl----------------------------------
00500612   2/2  ----------------------------------------------------------------------
00464791   1/2  gytvllvshdlslleraadr...egg--------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00462761   1/2  plygadiviithdlsieevadrilall-------------------------------------------
00490731   1/2  llvvdatlgleaadrilvlleglgvpgvvlNkldlvaeg-------------------------------
00414121   1/2  kelaeqlgltvlivlnKiDllselthdlell---------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00475521   1/2  el--------------------------------------------------------------------
00478411   1/2  iilalellll------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00512891   1/2  ttndldeleladriallrrgrivelgpls-----------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00379961   1/2  aaLlrlleegevtieragitlllpagvtviaat-------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00368571   1/2  elg.....lrdladrleklvagglagllegaektaasilel-----------------------------
00434401   1/2  ..lldlpdlvifvdhdle----------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  evlekrlehylellekad.rvvvidag....gs-------------------------------------
00478441   1/2  lelvd-----------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  th.ldeaeraDrvavldd......Gtpeellarpanpyvrellgavpgllllallll-------------
00515532   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00513761   1/2  lgipiilvlnKlDllseeglelvlelleellellpilllgvgpkdldli---------------------
00477972   2/2  ----------------------------------------------------------------------
00493431   1/2  elgplieydyvivnddleealeelldiivvlllglil---------------------------------
00470732   2/2  ----------------------------------------------------------------------
00379261   1/2  vgltdllgrtvdfkntiiiltsnvge....lsg-------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00498811   1/2  aplygaadividndlsleevvdril---------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00464411   1/2  kkrlehylelaepykddvvvidan....gsiee-------------------------------------
00510561   1/2  viDsltalapalelsllldeptsgl---------------------------------------------
00444381   1/2  ailsggfkqrvgia..lladpgilflDEidkll-------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00356411   1/2  lak-------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00477971   1/2  elaegfdvvivnhdleea----------------------------------------------------
00499191   1/2  ......lrpladlvifl.daspeelleRllkRgrlergddleevlerile--------------------
00496571   1/2  ......rlgdteevlehrleraeeladr------------------------------------------
00503741   1/2  ldpetlspdvlelLlrlleegkltdkllgltliltthdldllerladrllsrfngkgivi----------
00477012   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00487021   1/2  lrellpegilpdlvifldadpeell..........eRllkRgresergepldlle---------------
00404192   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00470731   1/2  Rpgrllldep..eldppdreerleilkrllkklgtvldvthddelarlad--------------------
00420942   2/2  ----------------------------------------------------------------------
00468951   1/2  erllsggkpqlvviDsltalrpalllldeptgellgldvrllsellrllkrlakelgvtvil--------
00498531   1/2  sggkpdlvviDsltalapslllldepgrvtqgldarllreilrllkrlakelgitvlltshv--------
00405882   2/2  ----------------------------------------------------------------------
00439861   1/2  tvilvsqltelildalagggaleqlad-------------------------------------------
00532471   1/2  lplpdlviyldadpeell..........eRllkRgrdpeeqerlddleevl-------------------
00404191   1/2  lilttnnrpeeldqallrllsrldrvivldlppdleergeilkrlaeklglplsdev-------------
00498532   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00480251   1/2  ldgvvltkldlvaalgaalsvalilglpil----------------------------------------
00489631   1/2  eilerlarleeryradlvivtd------------------------------------------------
00406781   1/2  leelrllsgvtviattndleeldpallrpgrfdrviel......plpdleerleilkllle---------
00495771   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00477011   1/2  sda.lellkelleegkrtivvvtKi---------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00405881   1/2  ......lggtvvlvSahdgegldelld-------------------------------------------
00392701   1/2  leglrllsgvtviattnrpee-------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00513251   1/2  atspevlierlldrvllldegslvdlgvledl--------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00420941   1/2  ldglqalsnvtviattnrpeeldpallrpgRfdlviefplpdeeerleilklllekl-------------
00482722   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00432181   1/2  ell-------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00482721   1/2  dseeeiekrleryreiaplleaadlvidndgsl-------------------------------------
00367291   1/2  lrvlsgvlvi------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00394721   1/2  lledgn----------------------------------------------------------------
00402371   1/2  v---------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00437921   1/2  tlilt-----------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00469161   1/2  .............................fpdl-------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00478081   1/2  pdlvifl.dadpevll..eRllkRgrrerkddseevlellekrleryepllel..ye-------------
00496062   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00437901   1/2  gvlii-----------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00499331   1/2  lekrleryeeltrdlielyeeadrvividag.....lsi-------------------------------
00430122   2/2  ----------------------------------------------------------------------
00386741   1/2  lteldglllp------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00527261   1/2  lld-------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00487061   1/2  gyllggldleevkaleelllvlpkp.................dlviy-----------------------
00478392   2/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00472911   1/2  lvifldadpevlleRllkrgrallreevldrllevrepyelleeadlvidtsg-----------------
00418301   1/2  g---------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00511381   1/2  vtglemdfagelfegsl-----------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00416171   1/2  gggi..vlpadvrlia------------------------------------------------------
00480441   1/2  lapeleyyeelgladvvivnddlee---------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00430121   1/2  d---------------------------------------------------------------------
00473941   1/2  tilggglvvv------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00521551   1/2  r---------------------------------------------------------------------
00496061   1/2  rlerylelyerliepykkadyvivi---------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00509891   1/2  llrdlldlvvlvvldgivllvdaidrleaadllvlnkldlveiad-------------------------
00533151   1/2  ............................grlirleddseevlekrlerylklyerliep-----------
00476071   1/2  evlleRllkRggdsleeie---------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  erleryreeleplleeydda--------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00482661   1/2  ...ggpvi..------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478391   1/2  .............pdlvifldapleelleRllkrgrhp...eseevleerl-------------------
00497571   1/2  ................------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00517691   1/2  kevlralrladgallvvdad--------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  .................eadvvllvvdadrglleqdlellelllelgk----------------------
00501942   2/2  ----------------------------------------------------------------------
00483811   1/2  lnfpdyvvvltvdleiil----------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  gldarelrellrlLkrlakelgvtv---------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  lvgnKlDl--------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00378842   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  npvqlertpviittNrl-----------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00360951   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00373851   1/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  adgrdigtvvfpdaelvkllleasleeradrvlvvivsdgRlddleelilerller--------------
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  .........lrellpepdlvvfldaslevlleR-------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00486921   1/2  rlerlreeyeplleeyddavvvidad....gsieevveeilelle-------------------------
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ..................----------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  ...-------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  llerlgk---------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           DALRLQKSITAASNASARFADEKMDLELQKTETKKSLSSVILSKREPEKDKEYGLGTLIKFISSFNAAEW
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00422811   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00422812   2/2  ----------------------------------------------ekeekr.........llrylkpyk
00500442   2/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00530602   2/2  ---------------------------------------------ep.k..........R.llrylkpyk
00469452   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00378842   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00360951   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00373851   1/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           KLMVTGLAVSIICGAGQPTMAVFFSKCISALALPPPLYDKLRSDANFWCLMFLMLGIVMFFAYSIQGSLF
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00422811   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00422812   2/2  kllllalllallaallslllplllgrlidallpggd.....lslllllallllllallrallsylrsyll
00500442   2/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00530602   2/2  kllllalllsllaallslllplllgqlidalllggdlsdpllllstlllllllllllallrallsylrsy
00469452   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00378842   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00360951   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00373851   1/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           AYCSEKLIYRARSKAFRSMLRQDIAFFDVDENSTGALTSFLSTETKHLSGISGVTLGTILMVTTTLAASM
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00422811   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00422812   2/2  arlgqrllarlrsrlfrkllrlplsffd..ktstGdllsrltnDveaidellssllltllralltllgal
00500442   2/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00530602   2/2  llarlgqrlsarlrlrlfrkllrlplsffd..ktstGdllsrltnDveaidellssllltlllalltlig
00469452   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00378842   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00360951   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00373851   1/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           VVGLAIGWKLALVCISCVPVLLACGFYRFWILAAFQRRAKKAYEASASYACEATSAIRTVASLTREPDVS
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00422811   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00422812   2/2  ivlfylswrlalvlllllpllllltllfgkrlrklsrlvqealselnsvlveslsgirtvkafgaeerel
00500442   2/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00530602   2/2  alivlfliswklalvlllllpllllltllfgkrlrklsrlaqealselnsllveslsgirtvkafgaeer
00469452   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00378842   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00360951   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00373851   1/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           GTYHGQLVVQGKKSLVSILKSSTLYAASQSFMFFVLALGFWYGGTLLGKGEYTLFQFFLAFSEVIFGAQS
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00422811   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00422812   2/2  erfeealdelrkaslklarlsallspllqllsalalalvlllgallvlngeltvgdlvafllyalqllgp
00500442   2/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00530602   2/2  elerfdealdellkaslklarlsallspllellsalalalvlllgaylvlngeltvgdlvafllyalrll
00469452   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00464792   2/2  -------------------------------------------------------------lsvpvgdkl
00371631   1/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00495772   2/2  ---------------------------------------------------nellrpivanvdlvlivvd
00482721   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00378842   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00360951   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00373851   1/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           AGTVFSFAPDMGKAKSAAADFKKLFDRRPPIDTLSKEGDDVEHIEGTIEFRDVHFRYPTRPEQPVLRGLN
00422802   2/2  -----------------------------------------------llllllallllllllllldplle
00422801   1/2  ----------------------------------------------------------------------
00490802   2/2  -----------------------------------------------llllllllalllelleeeeelll
00490801   1/2  ----------------------------------------------------------------------
00510252   2/2  -----------------------------------------------lllllllllaeellelleeeell
00510251   1/2  ----------------------------------------------------------------------
00379582   2/2  -------------------------------------------lepllevenlsksy...ggvlalkdvs
00424962   2/2  --------------------lgepldglgplr..........papgllelenvsksygtg...ialidls
00509432   2/2  -----------------------------------------------Mlelknlslsnfr.....vlkde
00367902   2/2  -----------------------------------------------lelknlslsyg....ksilkdvs
00482201   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00482202   2/2  --------------------------------------------llllelknlsksy...ggvlalkdvs
00530591   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00458602   2/2  ---------------------------------------------lllevenlsksyg...gvlalkdvs
00530592   2/2  -----------------------------------------------llllllaleelpllgelllevkn
00367901   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------lpllelenlsksy...ggvlalkd
00482262   2/2  ---------------------------------------------lllevenlsksy...ggvlalkdvs
00422811   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------lpllelenlsksyp.gggvlalkd
00475991   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00475892   2/2  -----------------------------------------lllelllevknlsksy...ggvlalkdvs
00440862   2/2  -------------------------------------Mpllslgepllelenlsksy...ggvvalkdis
00475992   2/2  ---------------------------------------------------lllaaelpelgelllevvn
00378981   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00422812   2/2  lsqlgsllsel...........................................................
00500442   2/2  -----------------------------------------lllelllelknlsksy...ggvlalddvs
00425572   2/2  -----------------------------------------------lelenlsksy...ggvlalkdvs
00379602   2/2  --------------------------llllpllllpdeplaaldvalqralvslerllellvdpgasdih
00502741   1/2  ----------------------------------------------------------------------
00502742   2/2  ---------------------------------------------lllevenlsksy...ggvlalkdvs
00390411   1/2  ----------------------------------------------------------------------
00404102   2/2  ------------------------------------------------elenlsksy...ggvlalkdvs
00500441   1/2  ----------------------------------------------------------------------
00390412   2/2  -------------------------------------------------Mknlslrygn...fralkdvs
00404101   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00466972   2/2  ------------------------------------------llalllevknlsksy...ggvlalkdvs
00425571   1/2  ----------------------------------------------------------------------
00468692   2/2  --------------------------------------------lsvpvglallgrvldvlgepidglgp
00466931   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00468602   2/2  -------------------------------------------------------------------dls
00361212   2/2  -----------------------------------------------plellgepllelenlsksyg...
00436512   2/2  --------------ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletg
00485452   2/2  -----------------------------------------------------------skiygdealkd
00466932   2/2  ---------------------------------------------------------------Mkllsls
00485932   2/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00436072   2/2  ---------------------------------------------pllelenlsksygg....lalkdvs
00468601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00448932   2/2  -----------------------------------------------------------------Lddvs
00530601   1/2  ----------------------------------------------------------------------
00422142   2/2  -----------------------------------------------dlsleelekllelllrdllglgp
00530602   2/2  gplrqlgsllselqralaaaerifelld..P..E.........................P.---------
00469452   2/2  ---------------------------------------------allelenlskiyggvp..kalddvs
00422141   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00368502   2/2  -----------------------------------------kerllllelrnvllddviGqe.eakeals
00448931   1/2  ----------------------------------------------------------------------
00372302   2/2  -----------------------------------------------yvlPllsdgmpllelenlrkpy.
00426051   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00367482   2/2  --------------------------------------------yvrPelldepllelengrhPllsksy
00498252   2/2  --------------------------------------------vekllglalllieklflkvlprllsl
00367481   1/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------alddvs
00437981   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437982   2/2  -------------------------------------------lveklrpknldkvi...gqeealkdls
00368501   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------lllllalelllevenlristgike
00488521   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00371632   2/2  -------mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrliklllee
00496112   2/2  ------------------------------------------------elenltkly...tgikaLddll
00495371   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00464792   2/2  lGrvldv.............lgepidglgpllalerl.pierlappllelenlskrfgtgi...vlidvs
00371631   1/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------esalellleledltklstg...ikaLddv.
00503372   2/2  ----------------------------------------------------------------Mmlksl
00381441   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00532532   2/2  --------------------------------------------------------------vlalkdvs
00480472   2/2  ---------------------------------------------------------------------s
00457311   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------lrplveklrpknlddvy...gqeevlkals
00495032   2/2  ----------------------------------------lsalellleledltkis...tgipaLddvl
00495031   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00500612   2/2  -------------------------------------pgllsllelllelenltklp...tgipaLddv.
00464791   1/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00490732   2/2  -------------------------------------------------------------------dvs
00484102   2/2  ----------------------------------------------------------------------
00462762   2/2  -----------------------------------------------------------yygdvtaldgv
00475522   2/2  -------------------------------------------------------------evlalhgvs
00478412   2/2  -------------------------------------------------------------Ggvlalhgv
00475381   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00379962   2/2  -------------------------------------------------yrpvdfddivGqee.alrals
00512891   1/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00379262   2/2  ------------------------------------------drllleelrpvllddviGqeeak.eals
00368571   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------mssgepllevenlskry...ggklalkdvs
00484101   1/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------llgvrllpplppklagll
00487022   2/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00444382   2/2  ---------------------------------------asdelekllelrpvlledvigqeeak.kals
00478442   2/2  -------------------------------------------------------------aevlalhgv
00498812   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------syggllalddvs
00503742   2/2  ------------------------------------------------fifldlrplallplpdrlvgrd
00533501   1/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00470732   2/2  ---------------------------------------------------------------------a
00379261   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00489572   2/2  --------------------------------------------------rvknlsksyggk...taldd
00392702   2/2  ------------------------------eklrpvllddvvgqeeakeallealaga....rlaledls
00464411   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00406782   2/2  ---------------------------------------------------------------lllkdls
00477971   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00477012   2/2  -----------------------------------------------------------------eelrk
00499192   2/2  ----------------------------------------------------------------------
00356412   2/2  -------------------------------------------------lknlsksyg...ilkalkdis
00515512   2/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00404192   2/2  -----------------------------------------vellpkvtlddlvgleelkealkealell
00464412   2/2  ----------------------------------------------------------------------
00468952   2/2  -----------------------------------------------------------------lnvlg
00510562   2/2  -----------------------------------------------------------------ldglg
00470731   1/2  ----------------------------------------------------------------------
00420942   2/2  -----------------------------------lrpvllddvigqeeakeallealalplkrldlgls
00468951   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00498532   2/2  ------------------------ldklgkildlalkileksflklevlalgvlerkeverlstGikaLD
00439862   2/2  ----------------------------------------------------------------------
00508672   2/2  -----------------------------------------------------hvsllklgeld....is
00515511   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00513252   2/2  --------------------------------------------------------------iellsdls
00477011   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00437902   2/2  ------------------------------------------------------------slllvekyrp
00405881   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00432182   2/2  ---------------------------------------------------------------------s
00394722   2/2  ----------------------------------lvslleslelplleklrpvlld.dvvgreealeall
00513251   1/2  ----------------------------------------------------------------------
00533152   2/2  ---------------------------------------------------------------------M
00499332   2/2  ---------------------------------------------------------------------P
00508671   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00367292   2/2  --------------------------------------vtlddvvgqeeakeallealelalkgldlfls
00480252   2/2  -------------------------------------------------------------------Edl
00402372   2/2  --------------------------------vlektgipltkllrpvllddviGqeealea..llealr
00386742   2/2  ------------------------------------------------klrpvllddvvgqeeakealle
00432181   1/2  ----------------------------------------------------------------------
00437922   2/2  --------------------------------------------------------------lglllvek
00495772   2/2  ardplfslnlllrylvlaeaagippvlvlnKiDlleeeedlelleellkelesigvdvvlvsakk.gall
00482721   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00521552   2/2  --------------------------------------------------------------------ls
00461622   2/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00416172   2/2  -----------------------------------------------------diigqeeakkalleals
00437921   1/2  ----------------------------------------------------------------------
00473942   2/2  -----------------------------------------------eklrpvllddvvgqeevk.kall
00420082   2/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00527262   2/2  --------------------------------------------------------------npfilgpk
00511382   2/2  ---------------------------------------------------------------------l
00476072   2/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00430122   2/2  -----------------------------------------------------------------rkgle
00386741   1/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00418302   2/2  ---------------------------------------drplleklrpvllddviGqeeakkalleala
00487062   2/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00482662   2/2  --------------------------------------------------kkvaivllsnyalsislddl
00472911   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00517692   2/2  --------------------------------------------------------------------ls
00416171   1/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  --------------------------------------------------------------------ls
00509891   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00497572   2/2  -----------------------------------------------------------------aselv
00482661   1/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  ---------------------------------------------------------------gelknls
00493172   2/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  -----------------------------Plsklleddlplllklrpdlfddvvgqdeaieallealrra
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  ------------------------------------------edleslllnplvkfedivpkvlddleea
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  -----------------------------------------------------------yggllllkdls
00486892   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00471272   2/2  --------------------------------------------------------------prailele
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00441252   2/2  ---------------------------------------------remsmsewilerldklledidwnpi
00378842   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------rellllllllll
00378622   2/2  ------------------------------------------------------------glklllrrls
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00476652   2/2  -------------------------------------------------yeplveklrpvllddlvgqee
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00474202   2/2  --------------------------------------------------------------deelelle
00453762   2/2  ---------------------------------------------------------------vwvpdee
00360951   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00373851   1/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00387322   2/2  ------------------------------------------------------------glkglllrlk
00488192   2/2  --------------------------------------------------------------fllsllrr
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  ------------------------------------------------------------------rrll
00470232   2/2  ---------------------------------------------------elaellsllierlllrdll
00486921   1/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  --------------------------------------------------------------------il
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           LSVKPGQYVALVGPSGCGKSTTIALLERFYDTLSGGVYVDGTDITRWNVSAYRSFLALVSQEPTLYQGSI
00422802   2/2  lenlsksyggrl.vlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldgldilalsl
00422801   1/2  ----------------------------------------------------------------------
00490802   2/2  lllalllllgdpllelenlsksy...ggvpalkdvsltikpGeivalvGpnGsGKSTLlkllagllkpts
00490801   1/2  ----------------------------------------------------------------------
00510252   2/2  lllllllllllgdpllelenlsksy...ggvpalkdvsltikpGeivalvGpnGsGKSTLlkllagllkp
00510251   1/2  ----------------------------------------------------------------------
00379582   2/2  ltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldglditalslaelrrrgigyvfqdpalfpgl
00424962   2/2  lpigkGervalvGpsGaGKttLlrliaglldpdsgeilldgvdigersrevtelleelrrviglvfqdpp
00509432   2/2  lvslefepg.ltaivGpNGsGKStlldalagllggrslrllragglsdliflgslirsgadrasvelvfd
00367902   2/2  leip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidlilkgllllprstvatvelifdllg
00482201   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00482202   2/2  ltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilglslkelrgigyvvqqdallpsltv
00530591   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00458602   2/2  ltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkditglspqelrrlggvvvqevllffltl
00530592   2/2  lsksyg...gvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkditdlslkel
00367901   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00378982   2/2  vsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllllslaelllllrrgigyvfqdpa
00482262   2/2  ltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdildlslaelrgigyvfqqdallpsltv
00422811   1/2  ----------------------------------------------------------------------
00420702   2/2  vsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgldllllslaellalrrgigyvfqdpal
00475991   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00475892   2/2  ltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilglsllellrrgigyvfqdpalfpgl
00440862   2/2  lsipkGeildlldellellkeldgsllnvalvGpsGsGKStLlnaLlgllkpdegvilvggkgvTrdivl
00475992   2/2  lsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdildlslaelrgi
00378981   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00422812   2/2  ......................................................................
00500442   2/2  ltikpgeivalvGpnGaGKSTllkllagllkptsGeilldgkdildlsl..lrrgigyvfqdpalfpglt
00425572   2/2  ltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllalsl..lrrrigyvfqdpalfpglt
00379602   2/2  inpggpvrvridgvlelllvvldllsldleellalasriavlagrdiserrlpldgallpdgsrvrvrls
00502741   1/2  ----------------------------------------------------------------------
00502742   2/2  ltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilglslaelrgigyvfqqlallpsltv
00390411   1/2  ----------------------------------------------------------------------
00404102   2/2  ltvepgeivalvGpnGaGKSTllkllagll.ptsGeilldgldltalslaelrrgigyvfqdpalfpglt
00500441   1/2  ----------------------------------------------------------------------
00390412   2/2  lelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgklsdlirrgadkasvelvfeldggllallrl
00404101   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00466972   2/2  ltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilglslaelllllrrgigyvfqdpalf
00425571   1/2  ----------------------------------------------------------------------
00468692   2/2  lllllllpivrlappllelenlsksygtg...ialidvsltigrGervglvGpnGaGKttLlkllagllk
00466931   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00468602   2/2  levkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyraaaae.rlgigavpqdvplfpslt
00361212   2/2  gitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvlldgleisalslaerlragigyv
00436512   2/2  ialddvsltikkGervglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelr
00485452   2/2  vsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpllltggkvlvigldifrlsarelrkrig
00466932   2/2  lgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGeilldgkdilalspeellrllrrr
00485932   2/2  LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi.......rr..igavpqlpvlfprlt
00436071   1/2  ----------------------------------------------------------------------
00436072   2/2  ltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldlla.....lrrgigyvfqdpalfpglt
00468601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00448932   2/2  lsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarla...areqlgivfqdp...gltv
00530601   1/2  ----------------------------------------------------------------------
00422142   2/2  lvklldplleeavvngasdihiepgggllrvryridgvlielifldeeellallsrlkslaglpilearl
00530602   2/2  ----------------------------------------------------------------------
00469452   2/2  lgiepGeivalvGpsGsGKstllrllagllaglptsGeillldgkdvlylsleesleqlrrrigyvfqdp
00422141   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00368502   2/2  ealelplkrpelfdglgvelpgknvlLvGppGvGKTtlaralakllga..pfiridgseltekdyvGesv
00448931   1/2  ----------------------------------------------------------------------
00372302   2/2  ..ggllvlndvsl...pgeivaltGpnGaGKSTllrllaglllpasggilvdgedlr..........igy
00426051   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00426052   2/2  ---kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdlggesglllrdlrrliglvfqdpi
00367482   2/2  g...gkvvlndislsip.gellvitGPngsGKSTllralaglllpasggilvpgedalll..........
00498252   2/2  lelenlskiy...tgipal.dvslglgGlppGeivlllGpsGsGKTtLalrllagllkpgggvvyidgee
00367481   1/2  ----------------------------------------------------------------------
00475372   2/2  lsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDirrpsarellgllgell..........
00437981   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437982   2/2  lalkpgeiphalllvGppGsGKttlaralagllgpdsgkilldgkdi........rrgiglvfqliglfp
00368501   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00488522   2/2  ...ldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGei...............ggkvlyv
00488521   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00371632   2/2  llrllgklalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifylpa.eqlk
00496112   2/2  slgippGeivllvGpsGsGKTtlalrllagllkptggkvliiglelsaeelrerrrrigyvfqepalfpe
00495371   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00464792   2/2  lpigkGervglvGpnGaGKTtLlkllagllkpdsgeivvyg..ligerprevrellglllelgvlf....
00371631   1/2  ----------------------------------------------------------------------
00495372   2/2  lggglpkGeivlllGpsGsGKttlalrllagllkp...evlvdgldltglspa..rggiglvfqteallp
00503372   2/2  elknfkslkdvsligdfspg.ltaivGpNGsGKStlldaiagllgpdsgeirldgkdlliylsdlirrga
00381441   1/2  ----------------------------------------------------------------------
00451572   2/2  MsikkgeiiaivGppGsGKsTlaklLakll....glivldgddl.......lreaiglvtqdgellleli
00532532   2/2  lviekGevvallGlSGsGKTTLlrllagllipddgeilidggdinleggfyakaigllrrkigyvfq..l
00480472   2/2  leikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilgeilldgkdltlvdtpgiargrlkll
00457311   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00437942   2/2  lalekgrpehlllvGppGtGKTtlakalaglllptsggvrvlgidaselld...................
00495032   2/2  sggipkGelvllvGpsGsGKTtlllqlagllalglgliplggkvlyigleltlsperlrlraqsl.....
00495031   1/2  ----------------------------------------------------------------------
00381442   2/2  -----GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprlgevdgvdltfls....reeigyv
00437941   1/2  ----------------------------------------------------------------------
00500612   2/2  lgggipkGeivllvGpsGsGKTtlllqlagllapdsgeillggkvlyislee..slrrrrigmvfqelgl
00464791   1/2  ----------------------------------------------------------------------
00414122   2/2  ---kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeilidgqlledlgvlavrlgigyvpqt
00462761   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00457312   2/2  ---mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddlyklsreelrklrrrigmvfqdpal
00490732   2/2  lsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDpyrpaadellgvlaee...........
00484102   2/2  ----kgpvigivGpsGsGKTTllraLagllkprggrvavigldigrldldellgigylfqdvgllpvltv
00462762   2/2  sltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddlr......lglliglvfqdpdllp
00475522   2/2  ldve.gevvllvGpsGsGKStllralag.....sGeilvdg.dlv..dleplrrdigmvfqdpalfpllt
00478412   2/2  sldve.gevvlltGpsGsGKStllralagl.....Gtilldg.dlvrlglkd...gigmvfqdpalfpll
00475381   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00379962   2/2  lalaagppegvllvGppGtGKstlaralagllppdsgrivlvgnlsdlldpkdlrellragiplvflnfa
00512891   1/2  ----------------------------------------------------------------------
00512892   2/2  ------evilltGppGvGKTTlakalagelgakfgsvsltgrdv.....rsarrgigyvfq.......tv
00379961   1/2  ----------------------------------------------------------------------
00475382   2/2  ----mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlavlsrdllgllreglirigyvfqdy
00379262   2/2  ealrlplkrlelferlglrrpgknvlLvGppGvGKTtlaralAkllga..pfvevdaselteggyvgedl
00368571   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00387202   2/2  lsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftlvreyelGeilldgrdlyrlsleealll
00484101   1/2  ----------------------------------------------------------------------
00533502   2/2  ----rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepigtp....lgrgigyvfqdpalfpgl
00368572   2/2  plagladgdglgvllGklldgvpvtldlgelgrhllivGptGsGKStllrllaglllpdggrviviDpkg
00487022   2/2  -------rmkiivltGpsGsGKsTlarlLaell....gvvvidtddllra.........gevfqdyalfp
00387201   1/2  ----------------------------------------------------------------------
00444382   2/2  lalelplkrlelfgklddligrspairrllellgarpgenvlLvGppGtGKTtlakalakllgv..pfir
00478442   2/2  sldin.gegvlivGpsGsGKStlalaLagl.....Gailvdd.dlvll..elrgrdilmvfqppalfpll
00498812   2/2  ---kPgkiigltGpsGsGKsTlarlLae.l....gvividgddltrelvaggglliglifqdfgl.....
00434402   2/2  lsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyrpaaelllreglgidfqlpdal..
00503742   2/2  eeiealskalgg.....aldgvslsiepggivllvGppGvGKTtLakllagllkpkfgeillfg.kvvyv
00533501   1/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00515532   2/2  ----kgekvallGlsgsGKSTllnrllglefaygpTigptsgtieidgvklqlwDtgGqerfrslwilyf
00493432   2/2  ----kGelivllGpsGaGKsTllkllagllgptsgvisvggt..treprpgevrgigyvfqsgalfphli
00513761   1/2  ----------------------------------------------------------------------
00477972   2/2  ---hkgelvvlvGPsGaGKsTLlnaLlgll.ptsgvisvsgttrpprpg..evdgvgyvfqsrelfpelt
00493431   1/2  ----------------------------------------------------------------------
00470732   2/2  rpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTTlaralakel...gagfilidgddl
00379261   1/2  ----------------------------------------------------------------------
00513762   2/2  ------kiiaivGkgGsGKTTllnklaglla.dggkvlvidlDparanlpeqlgi....dirdlidletv
00498811   1/2  ----------------------------------------------------------------------
00489572   2/2  vslsvepG.ivgLlGpNGaGKSTllrllaGllkpt...................................
00392702   2/2  lgirpgknvlLvGppGvGKTtlaralagll..........gapfgrvda.....................
00464411   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00496572   2/2  ----GkgelivllGpsGsGKsTlarlLagll...ggsvldtgepirgeplgelir..glvfqdpllldel
00356411   1/2  ----------------------------------------------------------------------
00406782   2/2  lgippgknvllvGppGtGKTtlakalagel..........gvpfvrisa.....................
00477971   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00477012   2/2  lldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrrptelrlsetpgltvl
00499192   2/2  ----kgkiigitGpsGsGKsTlaklLaellgatvgdvd..............gllvgvvfqddfylllpa
00356412   2/2  lelkkgikilllGlsgsGKSTllnrllgleygpTiginegtieidgvkltlwDtgGqesfrklwilyfeg
00515512   2/2  ----kgekvlllGlsgsGKSTllnrllgleflpgpTigptegtieidgvklqlwDtgGqerfrslwllyf
00487021   1/2  ----------------------------------------------------------------------
00404192   2/2  slgikpgeivllyGppGtGKTtlakalanelkkrggrvlyvsa...........................
00464412   2/2  --vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsgeplge...ligevfqdgilfpdlt
00468952   2/2  esidalgkilseilkllekgfltalgllerksverlstgikaLDlllgiGglprGelvlivGppGsGKTt
00510562   2/2  epldgllpilaklfrpievlalgllerksverlstGikaLDlllgiGglprGelvliaGppGsGKTtlal
00470731   1/2  ----------------------------------------------------------------------
00420942   2/2  lgirpgkgvllyGppGtGKTtlakalagel..........gapfiridg.....................
00468951   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00405882   2/2  -----gervglvGrpgaGKSTLlnaltglk.aivsgypgttldpnlgvvelddgrqlvlvDtpGliel..
00439861   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00498532   2/2  allgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleql..rarrlgldldelll
00439862   2/2  --kleeveristgipeldellgGglpkgslilitGppGsGKTtlalqlaanlaknggkvlyisleesreq
00508672   2/2  lsikkgevivlvGpsGsGKsTlaraLakrLeepgsgvvlldgddlraglsiglilsdedraalrrrlgev
00515511   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00513252   2/2  lsipspevvllvGppGsGKstlakklaell....gfilidaddlr.........................
00477011   1/2  ----------------------------------------------------------------------
00489632   2/2  ----MkgklillvGppGsGKtTlaraLaell..........glpfiridgddllrellgellgrgigfgf
00532472   2/2  ----pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvgelggaalldivdegrliglvfqd
00437902   2/2  vllddvvgqeeakeallealalararplkrpelflslgirpgrillLyGppGvGKTtlakalakel....
00405881   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00432182   2/2  lelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlgvveldgrkl..............
00394722   2/2  ealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpvvrldlsellsv.............
00513251   1/2  ----------------------------------------------------------------------
00533152   2/2  sldikkgklivltGppGsGKtTlarlLaerl....glpfistddllrelvpggldigevfqda.leagll
00499332   2/2  slslkkgklivltGppGsGKtTlakaLaerl....glpfidtddllrepvigagtdigevfqdlllaggl
00508671   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00482722   2/2  -----kgkiigltGpsGsGKsTlarlLae.l....glpvidtddlyrelvaggtplgerirellgegyll
00367292   2/2  lglrpgrnvllyGppGtGKTtlaralanel..........gapfirvda.....................
00480252   2/2  slavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDpyrpsapeqlgilgellg........
00402372   2/2  r..rpgrnvllvGppGvGKTtlaralagllvrssgpilldgvpfvrldaselle................
00386742   2/2  alkavllgirpgehllLvGppGtGKTtlaralagelga................................
00432181   1/2  ----------------------------------------------------------------------
00437922   2/2  lrpkllddvvgqeealerlllalkagklphlllvGppGvGKTtlaralarlllgsgggvdvieldasdl.
00495772   2/2  dilldilkgktvalvGpsGvGKStLlNaLlgellattgeipgdggdgrhtTrdvllirle....glvliD
00482721   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480442   2/2  ------rlivllGpsGaGKsTlaklLaellp...glivisvgdttrepregevlgvdyvfvdrelfeeli
00521552   2/2  lglrpgkgvlLvGppGtGKTtlaralagll..........gapfvrlsas....................
00461622   2/2  ----mkgmiialtGppGsGKsTlaklLaerl....glpfistddlyrevvergtelgklikdyfdpgalv
00394721   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00515352   2/2  ---mngklivltGppGsGKtTlaraLaerl....glpvistddllreavpggtdigelfqdyllfpfltv
00416172   2/2  laartgenvllvGppGtGKttlaralakllpr.......sgvpfvrvncsalte................
00437921   1/2  ----------------------------------------------------------------------
00473942   2/2  lalalallrgepgehvlLvGppGtGKTtlaralagllga...............................
00420082   2/2  -smkkglrIaleGpsGvGKTTlaklLarhlgptggrvllvgEPiaywrsvggsdlleliyqlplrldlge
00469161   1/2  ----------------------------------------------------------------------
00478082   2/2  -----gkvivltGppGsGKtTlarlLaellkplgggvvvidtddlrreairelllgldlleilf......
00478081   1/2  ----------------------------------------------------------------------
00496062   2/2  -----gklivltGppGsGKtTlaklLaerl....glpvistddllreevepggtdlgeifqalllagell
00527262   2/2  vdledfigreeelkeleeal..pkivlltGprGsGKTtllkalakelg..kpviyidlselsskgyvdle
00511382   2/2  lllkpgglvlitGPtgsGKsttLlralnrleeagkgvilvkdaidtrlgielvvsriglvleavglffal
00476072   2/2  ----kgkiigltGpsGsGKsTlaklLae.l....glpvidtddltregvllggpllerirellgegyllf
00437901   1/2  ----------------------------------------------------------------------
00457852   2/2  ----PkgklivltGppGsGKtTlakaLaerl....glpvistddllreavpg.gtrlgeviqdlfllggl
00499331   1/2  ----------------------------------------------------------------------
00430122   2/2  lgirpggnvllvGPpGvGKTtlakalagllfp.......sgvpfirinlselte................
00386741   1/2  ----------------------------------------------------------------------
00472912   2/2  -mkmkkgklilltGppGsGKtTlaraLaell....gapfisgddllrglageggkpl.............
00527261   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00418302   2/2  lplkrlelfeklrgirpgknvlLvGppGtGKTtlaralakll..........grpfirvdaselte..ae
00487062   2/2  ---ldMkkgklIvieGppGsGKtTlakaLaer.gargldvvviyepvdywaavgggdllrlirelllrlg
00420081   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00478392   2/2  -msikkgklilltGppGsGKtTlaralaerl....glpvidgddllrelvgeggrlgrdlfdedrllfre
00482662   2/2  llildlykevqvaydnfykvdesdiayqyallakedenaaaflksnrqkklvrdladrviaeerlellek
00472911   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00516042   2/2  -mlk.gklillvGppGsGKtTlaralaeel....glpfvvidaddl..lrgeelgriielfdearelvpe
00511381   1/2  ----------------------------------------------------------------------
00517692   2/2  felkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg.............................
00416171   1/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00469162   2/2  ------llIvieGppGsGKsTlaklLaerlgltglsvlltredgfgtplgelirelllegfqdlilvpdl
00430121   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  lelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdpilgv......................
00509891   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00489392   2/2  lsikkgklivltGppGsGKtTlakaLaerl....glpvistddllr------------------------
00515351   1/2  ----------------------------------------------------------------------
00497572   2/2  qwlldlgildeseilledlenalalllsligaklvkdllllvlkylpsllslldvlrpkvdfddiileea
00482661   1/2  ----------------------------------------------------------------------
00478132   2/2  -----kgkvivltGppGsGKtTlarlLaellkplglgvvvidgddlrre---------------------
00410532   2/2  lelkkglkillvGlngvGKTtllkrlag..........................................
00493172   2/2  -----mgklivllGpsGaGKsTlaklLaekl....glivlsvgdttrepregevdgvdyvfvsgelfkel
00478391   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00512062   2/2  ---kkkkgklivltGppGsGKtTlakaLaerl...gglvvidtddl------------------------
00402382   2/2  rkglnlglkprgnvlLvGppGtGKTtlaralakal..........gvpfvrinlselteallvsdliGhl
00491902   2/2  ---lmkgkiilltGppGsGKttlakaLaeel....glpfidtddll------------------------
00457882   2/2  ----mgklivltGppGsGKtTlaklLaerl....glpvidtddllrele...........pdgtelgell
00519582   2/2  ----kpkvilltGppGvGKttlarlLakll...glpliidldalaellfgdvgglvvdli..........
00477722   2/2  -----kpklilltGppGsGKttlaraLaeel....glpfidtddll------------------------
00462582   2/2  lealaeaklpppkgvllyGppGtGKTtlaralakel..........glpfvrinasd.............
00480502   2/2  -----MgklillvGppGsGKtTlaralaell...ggvvvidgddlrralvggl.................
00486922   2/2  ------mlivltGppGsGKtTlakaLaerl....glpfistddllreavpggtd.lgelfqelllegell
00519581   1/2  ----------------------------------------------------------------------
00493982   2/2  ----kpklilltGppGsGKttlaraLaeel....glpfidaddllr------------------------
00409841   1/2  ----------------------------------------------------------------------
00501942   2/2  ------klilltGppGsGKttlaralaeel....glpfidaddllrelv.....................
00483811   1/2  ----------------------------------------------------------------------
00509892   2/2  -----pkvigitGpsGsGKTTlanaLarllkarglkvavidrdpgrld......................
00477562   2/2  ---kkpkvillvGppGsGKtTlaraLakrlaelgkgvvvidtddlr------------------------
00483812   2/2  -----PkvillsGpPGvGKTtlaaaLakyLksqgldvlvldldellrgllgqpklydlle..........
00512061   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  lelkkglkilllGlngaGKTTllnrl--------------------------------------------
00486892   2/2  ----m..livltGppGsGKtTlakaLaerl....glpvidtddllreleidgtplgeeirdlllagellf
00482552   2/2  --everlstgipalDellgGglppgslvliaGppGsGKTtlalqlaanaalplelgklggkvlyisteea
00479332   2/2  -----apkli.ltGppGsGKttlakaLaeel....glpfidtddll------------------------
00482551   1/2  ----------------------------------------------------------------------
00471272   2/2  sliksllekllellkrlslklkkglk--------------------------------------------
00515802   2/2  ------llIvltGppGsGKtTlaklLaerl....glpfistddllreav---------------------
00401212   2/2  -elkrglnvgivGhvgaGKSTLlnaLlgll........................................
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ------klIvleGpsGsGKsTlaklLaekl....glpfidtddl--------------------------
00410531   1/2  ----------------------------------------------------------------------
00441252   2/2  vkllkyqgvefigflealknilkgipkknclllyGPpgtGKstlakalagllggtvlsvnnsnl...nfw
00378842   2/2  ----kelkillvGdsgvGKstLlnrllgdefiveyiptigvdvytktveidgkkvklqlwDtaGqerfrs
00477561   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  ----k..livltGppGsGKtTlakaLaerl....glpfistddllreavlggtplgeeirdlleagallp
00480501   1/2  ----------------------------------------------------------------------
00464422   2/2  ---MkkgkfIvieGpdGsGKTTlaklLae.l.elgigvvvtrEP--------------------------
00373852   2/2  llkgkpkviavtsgkGGvGKTTtaanLaaalaerGkkVllvdaDp.qaslsd------------------
00378622   2/2  lllkkglkvllvGlpgvGKstllnrl--------------------------------------------
00459702   2/2  -----MpkvillvGppGsGKTTlakaLakrlgekgvkvvvidtddl------------------------
00493062   2/2  ------mlIvltGppGsGKtTlakaLaerl....glpvistddllr------------------------
00441251   1/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00476652   2/2  akeallealaggrpprpvllvGppGtGKTtlaralanelgrpfvpvallcfvrvncaallelsasdll..
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00474202   2/2  klslllveklrpvllddlvgqeeakeallealragrpghvllvGppGtGKTtlaralanel.......pr
00453762   2/2  eglvlalvlsdgslllvkldlllllnplkllgveDlal--------------------------------
00360951   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  ----kglkivlvGdsgvGKTtLlnrllgdefpvsyiptigvdfyvktveidgkklvkltlwDtaGqerfr
00373851   1/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00387322   2/2  lelkkllkillvGlpgvGKTtllnrl--------------------------------------------
00488192   2/2  lslllkrllkvalvGlpgvGKStLln--------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  --dlgllliyeevllydvvprgrliv--------------------------------------------
00503172   2/2  ---psgrlivltGPsGsGKsltdtlskaLleelplkfgfsvsdttrvvdislipregevdgvdylfvsre
00463152   2/2  ------MkiIgltGpiGsGKsTvaklLaekl....glpvidtgDilrkalyratglgalakiislielli
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  lelkmllrvgivGlpNvGKSTLfnaLtgakvaivanypftTldpn-------------------------
00470232   2/2  lelkll.kvllvGdpnvGKStLlnrl.kivsd--------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ---pkgrpivLiGpsgsGKs.ladlladrlg....lpvphttrpprege---------------------
00453761   1/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00484262   2/2  ---kkllkialvGhpnvGKStLlnrl--------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00523462   2/2  --------akvalvGlpnvGKStLln--------------------------------------------
00348322   2/2  ealrsgrvvllvgptGsGKTtlalal--------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  -----mkviavtsgkgGvGKTtlaanLaaalaerGkkVllidaDpqgpslsl------------------
00476651   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00360952   2/2  ------kviavtsgkGGvGKTTtaan--------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:1260
query           RDNILLGITEDDVPEEAIIEACKAANIYDFIMSLPDGFSTLVGSKGSMLSGGQKQRIAIARALIRDPKIL
00422802   2/2  aelrrrigyvfqdpalfpltvrenlalgllla.llllglskaeararalellellplgldtlldrlvgeL
00422801   1/2  ----------------------------------------------------------------------
00490802   2/2  Geilidgkditglspqelrrlgglvlqdvllffltll................lllaakeaalralllll
00490801   1/2  ----------------------------------------------------------------------
00510252   2/2  tsGeilidgkditglspqelrrlgglvlqdvllffltll................lllaakeaalraell
00510251   1/2  ----------------------------------------------------------------------
00379582   2/2  tvrenlalglllllllllllllllllalskaearervlellelvgldtlldrlvgeLSgGqrqrvalara
00424962   2/2  lfprltvaenialga......eyfrdegadvllladsllrlagalrevlgrlgrelSgGqkqrvaiaral
00509432   2/2  lsdglyllerselilrrlilkpgsgeilingkdislldlrelrrligyvpqdpnllfqltvlenlllgpe
00367902   2/2  llliirrlilrdgsgeilidgkdislldlrelrrligyvpqdpalfpqltvlenlllglelrrklldell
00482201   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00482202   2/2  lenlllglll..lgllllllaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpkll
00530591   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00458602   2/2  lenlllglallllllvlllllllllllllaakeaalralllllllgledlldrlpseLSgGqrqrvalAr
00530592   2/2  rgigyvvqqdallpsltvlenlllglll..lgllllllaakeaalralllllllgletlldrlpseLSgG
00367901   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00378982   2/2  lfpgltvrenlalgllla..glskaeaaaraaellell.....glddlldrlvgeLSgGqrqrvalaral
00482262   2/2  lenlllgllllgellll.llaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpdll
00422811   1/2  ----------------------------------------------------------------------
00420702   2/2  fpgltvrenlalglllag..lskaeararalellell.....glddlldrlvgeLSgGqrqrvalarall
00475991   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00475892   2/2  tvlenlllgll......llglalkeaalralllllllgletlldrlvseLSgGqrqrvalarallldpkl
00440862   2/2  ytledgvkltliDtpGlgdtklsdeeklilkyleeadlvllviddglteldlellkllkelgkpvilvln
00475992   2/2  gyvfqqdallpsltvlenlllglllagelll.lllaakeaalralllllllgletlldrlpseLSgGqrq
00378981   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00422812   2/2  ....................................................qrarvaaeRi...DP---
00500442   2/2  vlenlllgll......llglslaeaaeralelllllgledlldrlvseLSgGqrqrvalarallldpdll
00425572   2/2  vrenlalgllll..glskaeaaaralellell.....glddlldrlvgeLSgGqrqrvalarallldpdl
00379602   2/2  plptllggeslvirklpkliltledllelenlsfsy...ggkealkdlslaiepgelvlivGptGsGKTT
00502741   1/2  ----------------------------------------------------------------------
00502742   2/2  lenlalgllllglskaeaaaraaellell.......gledlldrlpseLSgGqrqrvalArallldpdll
00390411   1/2  ----------------------------------------------------------------------
00404102   2/2  vrenlalgll..........kaeararalellell..gldelldrlvgeLSgGqrqrvalaralllllee
00500441   1/2  ----------------------------------------------------------------------
00390412   2/2  lslsggeklrvalakallgnpeillngepvnhldlrelllnllrrrgiglvpqehdlfplltvaeniall
00404101   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00466972   2/2  pgltvlenlllgll..llglllllaakeaalrlellllllgletlldrlvseLSgGqrqrvalarallld
00425571   1/2  ----------------------------------------------------------------------
00468692   2/2  pdsgeilvdGedlr..elrelrrrigyvfqdpalfpeltvlenlalgallag..................
00466931   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00468602   2/2  vldnlalar........dlleaakaagydvvlidtaglld..ldrlvgelsggqkqrvaiarala.apev
00361212   2/2  fqdlalfpeltvlenlalg..................rarellerlglail...drlpgeLSgGqqqrva
00436512   2/2  rrigyvfqdpalpallrllalfpaltvaenlrfglglavlll..ldsatrlaqakreisalarellervg
00485452   2/2  .vfqdpallphltvpenldlglll..eilervlellelvgldvvlldtyph...........elSgGqrq
00466932   2/2  igyvfqepalfpgltveenlllglllrlllelllgrlelllllllllellallldlllllllllllllll
00485932   2/2  vlenlalg...gadlaeraeellellglegfdvvliDtag..rgrrvgelsggqkqrvaiarallllldp
00436071   1/2  ----------------------------------------------------------------------
00436072   2/2  vlenlalgllllgll.......ealaralellellglgdl...drlvseLSgGqrqrvalarallldpdl
00468601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00448932   2/2  lenlalg.....eleararellellgledydvvliDtag..rlrlpselsggqkqrvaiaralaaplppe
00530601   1/2  ----------------------------------------------------------------------
00422142   2/2  pqggriqavlppvvvdfrvstlpdigglslvirklreviltledlglsy...gdpealkdlslaippggl
00530602   2/2  ----------------------------------------------------------------------
00469452   2/2  alfp....................aeellelvgledlldrlpge...........lSgGqrq..aiara.
00422141   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00368502   2/2  earlrelfeeaigyvfqdpalfpgtvlenlalgllvseligappgyvggdlggllteavlealriklveg
00448931   1/2  ----------------------------------------------------------------------
00372302   2/2  vfq.......................................llerv.gledlldrlpstlsgGqrqrva
00426051   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00426052   2/2  lfpgltvglllffldnidlgllirg..deeleaalelaglprvielllegldtlaggggvvlsGgqrqrv
00367482   2/2  .............................rvdeiltrvglsdlldrgl...........s.lsggerqrv
00498252   2/2  sldll...rarrlgvvlqelllfpeltveenl......................................
00367481   1/2  ----------------------------------------------------------------------
00475372   2/2  ....................................gldvlvgarggdlsgglrqr..larallgdpdvl
00437981   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437982   2/2  hltvlelvalgl..ggilveevrellkel.......................lsgGqkqrvaiaralagd
00368501   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00488522   2/2  dqeeslfpltvlenlalg.......gedveellerlgl.dlldrlph...........qlsggqrqrvai
00488521   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00371632   2/2  rigllfqkglpealdveell........................ellldlkegledil...vpvlsggqk
00496112   2/2  ltvlenlalgll.................................drlpgeldlSgglqrqrvaia...a
00495371   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00464792   2/2  ..............................aaellervglvaatadeppgelsggqrqrlaiAraladdq
00371631   1/2  ----------------------------------------------------------------------
00495372   2/2  pltvrenlealgldlrglldrerviellelvgleelldrlpre...........lsggnqrqrvvia.al
00503372   2/2  giayveqefdlfdgltvlenvllglgdeliirrrilrdgrseyllnglgvslkeliellldlsggelnrv
00381441   1/2  ----------------------------------------------------------------------
00451572   2/2  degilvp...deiviellrealeelda.d..gvildgfprllgqaelllsggkadlvifldaplevlleR
00532532   2/2  fpfltvlenvalgld.....glvdeedleraenllalvgleeipnrypse....lsgGqqqrv.......
00480472   2/2  learraaigivfqdvdllltltvaenlllg......ldllllellkelkydpvilllnkidllddrllrr
00457311   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00437942   2/2  ...............................................pselsggerqrvliaralladpk
00495032   2/2  ....................gldldellerllvidllelv.....gllelldrlprelsggqrqrvviDa
00495031   1/2  ----------------------------------------------------------------------
00381442   2/2  fqepallpdltvlenlylglllalllaleegkivildgdreraeellellgldadlviilpasleeller
00437941   1/2  ----------------------------------------------------------------------
00500612   2/2  dpdltv............arerviellelvgllelldrlpre...........lkrsggqrqrvviDara
00464791   1/2  ----------------------------------------------------------------------
00414122   2/2  lglfpaltvlellalalllredpdlilid.............................sgGqkqrlalar
00462761   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00457312   2/2  flnpgltvrenlaeplrllklgkk...............llepvglpevldryphelsgGqrQRv...ra
00490732   2/2  ...................................lgldvllgarggdlsgglrqr..larallgdydvl
00484102   2/2  renlalllrglpgysaeeleralellelagfdvilieGllelalplilelrelsdgqiqrvaparallrd
00462762   2/2  fltvlenvllpllaagliv..ivdgt.lllvglrealrkll...........gllsgGqkqrvadlvvll
00475522   2/2  vrenvilgllelaglskaealarvdellelvglddellldrlp..............sggqqqeilrvai
00478412   2/2  tvrengvalglllaglskaeieervdlllelvglddlldrypde...........lsggqrqrvaiaral
00475381   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00379962   2/2  alpasllesel...........................................lsggerqrvalarala
00512891   1/2  ----------------------------------------------------------------------
00512892   2/2  eellgllaelvglevrg...................eleellktlikelsggekqrvalarallakpdvl
00379961   1/2  ----------------------------------------------------------------------
00475382   2/2  alfprltvlenvllgll...............................llgglvvildggvrqrlalara
00379262   2/2  ekrirelfqearllvfltvlenirldasey..lekrvvsrligappgyvgyglggllteavrrlpysvll
00368571   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00387202   2/2  lfldeileidglllvelregigyvfqd-------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00533502   2/2  tvrenlelllvfadrygvlrglikpalae......gvsvildrvglsdlaydgfprllsgggrqrvalar
00368572   2/2  eyaglarglgvvildpgdgrsvrlnplaliddeedaaellralvsemgrgeddfftpaarallralilal
00487022   2/2  hltvlelldnvllgleirgllk.........aerlervevllervgllldrippalsgGqgqrvildral
00387201   1/2  ----------------------------------------------------------------------
00444382   2/2  idgselte....kelvGe....................................................
00478442   2/2  evrglniaevlelaglskaealkrvdlvlelvgld...........drypyelsggerqrvailr..vll
00498812   2/2  felldrellielllenlalglalegvildalrrrllelldllgldvvilegplllsgglrqrpdlvifld
00434402   2/2  ........................drellreevlellgl..gevvivdvydlsggerqr...aralasgp
00503742   2/2  nvselldlkellrll.............................................lealglpppy
00533501   1/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00515532   2/2  edadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenlanvpillvlnKiDlleakeraeelle
00493432   2/2  vagnllegaevhgllygtskerveealekgllvlldr...............dlsggqqlrvalaralvv
00513761   1/2  ----------------------------------------------------------------------
00477972   2/2  vagnflegaevrgnlygtsrer........veelleagldvlldidpqglsggqkqrlalaralilppsl
00493431   1/2  ----------------------------------------------------------------------
00470732   2/2  rekavgeleklgrdlfqvaregglvpdilfideidall............rkgpdvildgagrtpeqlea
00379261   1/2  ----------------------------------------------------------------------
00513762   2/2  me.lglgpngalvfaleellt.tldillealelleedydyiliD....tpGglelrallalllaiarala
00498811   1/2  ----------------------------------------------------------------------
00489572   2/2  ......................................................lallelrntteagaas
00392702   2/2  ......................................sdllgkyvgelsgglrqr..larallakpsvl
00464411   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00496572   2/2  tvlenlalgrylhl..glilaalaa..gvgvvldrvg.lsdlaygfprtlsglgqrqrvalarallkpdl
00356411   1/2  ----------------------------------------------------------------------
00406782   2/2  ......................................sellgkyvgelsgglrqrlalara..adpgvl
00477971   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00477012   2/2  vvflel........gerldllglvfqdfsllpelielenralagpiagisrdairleielpglpdltlvD
00499192   2/2  levlengafll...dlllpdaldrelllelllalveglvvlldryprllsggqrqrvaia.....dpdvl
00356412   2/2  adaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenvpi...ilvlNKiDlleekiveelle
00515512   2/2  egadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanvpillvlnKiDlleaklvllllvg
00487021   1/2  ----------------------------------------------------------------------
00404192   2/2  ...........................................delvsklsgglqeqrvaiafalarkpd
00464412   2/2  vlenvalgry..gll.glikealaegviv.....ildrvglsdla..ypgflsggeqqrvaiarallpkp
00468952   2/2  lalqlaanlaklggkvlyidteesldqlr...arrlgldlddllllpaltveellala............
00510562   2/2  qlaanlaaqggkvlyisteesleql..rarrlgldldrlllld...altv....................
00470731   1/2  ----------------------------------------------------------------------
00420942   2/2  ......................................sellgkyvgelsgglrqllalara..akpsil
00468951   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00405882   2/2  ..........aslgeglvrqalealeradvillvvdasdplldqpvellsggekqrlalarallgkpvil
00439861   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00498532   2/2  lpaltveellala.....................................erllsggkpdlvviDsltal
00439862   2/2  lleraerlgldleellllgll........................................siliadplg
00508672   2/2  fqelllagrlvvldgtalglelrdelrellkeaglpllvvfldaplevlleRdrrglypeelsgglkqrv
00515511   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00513252   2/2  ...................................................gqkqrvalleaalkegylv
00477011   1/2  ----------------------------------------------------------------------
00489632   2/2  qqgdlledatvlenlalllldeidka................ledggvvlldgfdrsqlqrlailralld
00532472   2/2  ldllpllevlellaa..............................rleellerippalsggqgqrvildr
00437902   2/2  ......gapvieidaselrd..................................................
00405881   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00432182   2/2  .........................................vliDtpGleefa........sggekqrva
00394722   2/2  ........................................sdlvg....elegglrgllteala.lakps
00513251   1/2  ----------------------------------------------------------------------
00533152   2/2  lfddefrglller.........................leellargpvvildgfpggllqrealrrlllr
00499332   2/2  lvddev......................rrlllealdell.laggkvvildgfpggllqrealrrllprp
00508671   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00482722   2/2  pdealfrallaellfgdllalalldgvv..............ydrlrdellaelsggqgdvliiegalll
00367292   2/2  ......................................selle..klvgegegrlrgalaealradpgvl
00480252   2/2  ...vpvvgvltgldlagalrealell...............llegydvvliDtagglqrglllalaladl
00402372   2/2  .........................................fgkyvgafegglrqllglaraa..kpgvl
00386742   2/2  .............................................pfvrldaselsggeklrgllarala
00432181   1/2  ----------------------------------------------------------------------
00437922   2/2  .rgvddlreligevlqalglllgg..............................................
00495772   2/2  tpGfrdtilenieke..eleatfeeireadlvllvidaihl-----------------------------
00482721   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480442   2/2  vagnlled........aivhgllygtskerieealdaglgvlldgfprglsqaqalrlaldlvllldpsl
00521552   2/2  .......................................elvgkyvgelegglrqllalaraa..npgvl
00461622   2/2  pdllirlllerllfldegggflldgfprtleqaeals...............kpavlsggrkqrlalara
00394721   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00515352   2/2  deni......rglllealeellaag..kvvild..............glsggllqrvallrallrpdlvi
00416172   2/2  ..................................dlleselfghekgafgggekqrlgllrla..dggvl
00437921   1/2  ----------------------------------------------------------------------
00473942   2/2  ..................................pfielsasdllg......esdlrggfkqa.......
00420082   2/2  islddaallllslqllfaapylslnevidaarvlladefikplpagykvvii------------------
00469161   1/2  ----------------------------------------------------------------------
00478082   2/2  ............................................eglllsdefrelleealalladgdvv
00478081   1/2  ----------------------------------------------------------------------
00496062   2/2  fddevlgll..............rerldelielllaggvvildgfpldlegalllrealarallpdl.vi
00527262   2/2  ellrela...............................eelgellellkkllkklsellglsilglelil
00511382   2/2  dllelll..........................................................qdpdv
00476072   2/2  dealdrellaallfglelegal...........................ldglvygvlqdrllerllaag
00437901   1/2  ----------------------------------------------------------------------
00457852   2/2  lffdeldel..................lkerieellaaggvildgfpldlegaealreallragplpdlv
00499331   1/2  ----------------------------------------------------------------------
00430122   2/2  ..................................kllvselighppg.yvGedelgvlfeaarkappsvl
00386741   1/2  ----------------------------------------------------------------------
00472912   2/2  ...........................................gllfedaleagfrqrladlirallakg
00527261   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00418302   2/2  lvGyesgarlrelf.....................................................ara
00487062   2/2  ...fgepdafdn.ellgellealleg....................gki.vlsarraqlleirlirplla
00420081   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00478392   2/2  llideidl.......................................................llakgkv
00482662   2/2  iieellrirldklledldeiveelppvlfddlvgqeeakeallenlklflkgpellldlglpkgrgllLy
00472911   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00516042   2/2  lallfideidell..........................akgkvvild......gtgrlleldealellg
00511381   1/2  ----------------------------------------------------------------------
00517692   2/2  ........................gtlllllgllsfllalvldslplerergitidvalarllldgrkil
00416171   1/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00469162   2/2  lvlellaanragl..relikellaagkgvildrfplsrl.......ayqlsggerqrlaidlegalller
00430121   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  .............................................................vlldgrdll
00509891   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00497572   2/2  keelllellelplklpelfkrlglkapkrrgvlLyGppGtGKTllakalakelgrl.pfirvn.......
00482661   1/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  ...............................gefvdygptigvnfktvevdgvklviwDtaGqerfrsll
00493172   2/2  i.............dagelledaivigllyergtlldavegalldgfpvlldgalqlllllrelllkpdl
00478391   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  dg.yvgededgiltgalr....................................................
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  qdlllag........gllpdaivrdlllelleelladgkgvildgfprdleqaealrallaelglppdlv
00519582   2/2  ...............................................dleaverhlldiaeellengeil
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  .............................................llvgllvgelegrlrglfteav..l
00480502   2/2  ...................................idgllilfledeaalselvlevllealegggnpdv
00486922   2/2  frdell..................dlllevieellaag.gvildgfplslegaqalrallrelgldpdlv
00519581   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00501942   2/2  ...................................................gesirelfeaagrlaprel
00483811   1/2  ----------------------------------------------------------------------
00509892   2/2  ............ldeplgvdrerlrrvgelalllagggl..calvaddlagaleel..laralaggpdvi
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  ............................ellelllde..............gekipveliiellkdvlvs
00512061   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00486892   2/2  raevrdll........................................yelllealeaggvvldgfpldl
00482552   2/2  fsperlreralsl.....................gldleelldrllvidatdlldllellerlrrllse.
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  .........................................ldtlkgelergitikigaasllldklaiv
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00441252   2/2  ladlidkkvvlldE--------------------------------------------------------
00378842   2/2  lle...lyyrgadgillvvdvtdresfeelkkwleeilrlle.....agvpiilvgnKiDllg..rqvlv
00477561   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  dalvr-----------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00476652   2/2  ....................................................eselfgeekea..flgal
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00474202   2/2  slpglpfvrvnasdltd.vglleellgkllgaat....................................
00453762   2/2  ----------------------------------------------------------------------
00360951   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  slre.............................lyyrgadgvllvydvtdresfe.....nvlswleelr
00373851   1/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  efl...........eklidedgflerievlgnl............gkvvvldidllqglkllrktylnpl
00463152   2/2  lfgelvpddlvldrlvlerlvfsdpee.vildg.phplvqaeild........................e
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:1330
query           LLDEATSALDSESEKVVQVALDAAAKGRTTIAVAHRLSTIQKADVIYVFDQGRITESGTHSELLAKKGRY
00422802   2/2  SgGqrqrvalArallldpdllllDEptsgLDpetraellellrelakgltvllvthdlslaa--------
00422801   1/2  ----------------------------------------------------------------------
00490802   2/2  llgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsgLDpetraellellrelakegktvllv
00490801   1/2  ----------------------------------------------------------------------
00510252   2/2  llllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsgLDpetraellellrelakegktvl
00510251   1/2  ----------------------------------------------------------------------
00379582   2/2  llldpdllllDEptsgLDpetraellellrelakegltvllvthdldealrladrilvlddGrivelgtp
00424962   2/2  lleragnleggGsiTalatvlveggsdpdllllDeptsalDgeivlslllalkrlyPaidvll-------
00509432   2/2  errelldellglellsleealaraeealeelnallkeleeeleligplldglellvglnglldrplselS
00367902   2/2  gllellalleellklleellkelevleaalaallkeeieeraeellellglgglldrpvstL--------
00482201   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00482202   2/2  llDEPtsgLDpetraellellrelakgltvllvthdlsearladrilvlddGrivelgtpeellenpgll
00530591   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00458602   2/2  allldpdllllDEPtsgLDpetraellellrelakegltvllvtHdldealrladrilvlddGriveegt
00530592   2/2  qrqrvalArallldpkllllDEPtsgLDpetraellellrelakgltvllvtHdlsealladrilvlddG
00367901   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00378982   2/2  lldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrladrilvlddGrivelgtp
00482262   2/2  llDEPtsgLDpetraellellrelakgltvllvthdlsealladrilvlddGrivelgtpeellenpgll
00422811   1/2  ----------------------------------------------------------------------
00420702   2/2  ldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrladrilvlddGrivelgtpe
00475991   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00475892   2/2  lllDEPtsgLDpetraellellrelakegltvllvthdldealrladrilvlddGrivelgtpeellenp
00440862   2/2  kiDllkkeelekllkslnkelglkelrrgigyvfqdpnlfpglvvlisaltgegldeltvrenlalglrl
00475992   2/2  rvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvtHdlsealrladrilvlddGr
00378981   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00500442   2/2  llDEPtsgLDpetraellellrelakelgltvllvthdlsealrladrilvlddGrivelgtpeellenp
00425572   2/2  lllDEptsgLDpetraellellrelakelgltvllvthdlsealaladrilvlddGrivelgtpeellen
00379602   2/2  llkallgllppdegiitiegpdel......lrnkigyvfQdpvlfpltvren..............----
00502741   1/2  ----------------------------------------------------------------------
00502742   2/2  llDEPtsgLDpetraellellrelakegltvllvthdldealrladrilvlddGrivelgtpeellenpg
00390411   1/2  ----------------------------------------------------------------------
00404102   2/2  lsldpdllllDEPtsglDpetraellellrelakegltvllvthdldealrladrilvlddGrivelgtp
00500441   1/2  ----------------------------------------------------------------------
00390412   2/2  delaglpkygnylsllkeklkelnallkelelqlkelarllelleglkeeaekakall------------
00404101   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00466972   2/2  pdllllDEPtsgLDpetraellellrelakegltvllvthdldealrladrilvlddGrivel-------
00425571   1/2  ----------------------------------------------------------------------
00468692   2/2  .....lglaeyldelgkdLSgGqrqrvalAr.....pvlLllDEptsgldalre.ilellrellkelgyt
00466931   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00468602   2/2  llldeptsgldalae..llelleel..gltvlvvtKlDgtakgghdlslalrladrilvlgvGeivedgt
00361212   2/2  iaralaldpdllllDeptsalssrssendpetvaellellkelakelgvtvilvthdldlldsallrpg-
00436512   2/2  lpgdlftllsrlderagnlSgGqrqrvaiaralasdpdllilDE--------------------------
00485452   2/2  RvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrtiilvthdlreae.adrilvlrk
00466932   2/2  llllvlllllllllvlllllllalllllalkeaallleelllllglgdlldrpvstLSGGer--------
00485932   2/2  elllldEptsglda..lrlllellkel..gltvlvvthddgtakggaalslaleladrilvlgdGeived
00436071   1/2  ----------------------------------------------------------------------
00436072   2/2  lllDEptsglDpetralllellrelaeelgltvllvthdldlalaladriv-------------------
00468601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00448932   2/2  vllldeptsglda.lrellellrel...gltvlvvthlDllakggadlslaleladrilvlgdGeivedg
00530601   1/2  ----------------------------------------------------------------------
00422142   2/2  vlltGptGsGKtTllralagllnpdegriltiedp............ieyvfqspnlfpl..........
00530602   2/2  ----------------------------------------------------------------------
00469452   2/2  ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtvilvtH.......Asdrvlvlrdgriv
00422141   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00368502   2/2  elgfrelerevlldlplhdasviallgggrelrdgellkalkeaeaeelle..llglkdlllrkpsqlSg
00448931   1/2  ----------------------------------------------------------------------
00372302   2/2  i.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfvtHdlelaalladrvvvlndgr--
00426051   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00426052   2/2  alar.....pdlllfldeptselleRllkrltrpgldadteeellellerlare----------------
00367482   2/2  alaralatdpslllLDEptsgldpedgaalaeallellaellgatvlvvtHdlelaalaadriv------
00498252   2/2  drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarellellrrllrlakelgvtvllvthd-
00367481   1/2  ----------------------------------------------------------------------
00475372   2/2  liDepgrgldpellallaelldllrelradlgllvvdathdldavlkaadrilvldlggivlnkld..lv
00437981   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437982   2/2  pkvlllDEpt.aldpdaqnaLlklleelakgvtvilathdlsellpallsrcqvirfpplseeelleild
00368501   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00488522   2/2  aralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlLkrlakelgvtvllvthdldevarl
00488521   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00371632   2/2  qrlalaralvedpdvlilDgptalldpltrellellkelrdlldltilvdadlevlleRrl---------
00496112   2/2  gdpdllllDeptsalrslgndpelraellrllkrlkelgvtvilvthdleeaedladsgria--------
00495371   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00464792   2/2  gkpvllllDEptsgldalreillllgellseegytvllvshdlslleraadr...eggsitalg------
00371631   1/2  ----------------------------------------------------------------------
00495372   2/2  allpkllllDEptsaldvslraeilrlLkrlakelgvtvllvthdleeveeladrvavlaggriveq---
00503372   2/2  alllqgevdlllldepterldfldelagleeykgnyeellklleeleellkelekrlellekele-----
00381441   1/2  ----------------------------------------------------------------------
00451572   2/2  llkrddekilkrleeqkqrvaiarallkkpailild----------------------------------
00532532   2/2  ....illldEPtsgLdpvsr.........................leladriyvllsGrivesgtt----
00480472   2/2  aeaeerieel------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00437942   2/2  vlllDEi.daldpeaqnaLlklleelpkgvtvilttnrleeldpallsRfdviefpppdeeelleilkl-
00495032   2/2  lalllrpell..DeptsaldvqlvaeilrlLkrlakelgvtvilvthdlrevegrleladrvvvlrggr-
00495031   1/2  ----------------------------------------------------------------------
00381442   2/2  ldrrggelsggqkqRvalaralll----------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00500612   2/2  lllrpel..lDEptsaldvslraeilrlLkrlakelgvtvllvthdlreveeladkrdrvvvlrggriv-
00464791   1/2  ----------------------------------------------------------------------
00414122   2/2  alladpdlgellllDeptlvlDaasgedlldllkelaeqlgltvlivlnKiDllselthdlell------
00462761   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00457312   2/2  laldpdllilDeptsalgqpdpelrelldllifldadlgltlirlitrdlgeagrsadrvl..-------
00490732   2/2  iiDtp.gtldvllelallellkellaelgadvvllvvdatlgleaadrilvlleglgvpgvvlNkldlva
00484102   2/2  pllllldedtvv----------------------------------------------------------
00462762   2/2  dadpevllaReptrgldpeteeeleellerleereplygadiviithdlsieevadrila----------
00475522   2/2  allilpvllgralallpelllldeptsaldpdlve-----------------------------------
00478412   2/2  alepelllldeptsaldplavvellelllglnee...............ldiilale-------------
00475381   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00379962   2/2  lrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevtieragitlllpagvtviaatnddlg....
00512891   1/2  ----------------------------------------------------------------------
00512892   2/2  llDEid.gldpdvleallelleelkrsgvtvilttndldeleladriallrrgrivelgpls--------
00379961   1/2  ----------------------------------------------------------------------
00475382   2/2  llldpdvllldepl--------------------------------------------------------
00379262   2/2  ldelekahrpirvlllsaslvlllgglglpevgelllellddvgltdllgrtvdfkntiiiltsnvgels
00368571   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00533502   2/2  alvvkpdlvilldeplevldeRlrkrgrlelreldseevlekrlehylellekadrvvvidagg.sleev
00368572   2/2  aeepeptldellellse...lglrdladrleklvagglagllegaektaasil-----------------
00487022   2/2  lselayqpdvllldeplsgldaklreelrdllrellpegilpdlvifldadpeelleR....llkRgres
00387201   1/2  ----------------------------------------------------------------------
00444382   2/2  ......segailsggfkqrvgia..lladpgilflDEidkllddrgeaegggdvsregvqnaLlrl----
00478442   2/2  pklllpdepgrnldvlievavlnlilkllgidallelv--------------------------------
00498812   2/2  appevlleRllkRggldeetiekrlelylelaplygaadividndlsleevvdrilal------------
00434402   2/2  dvlilDgptlgldv...........lldlpdlvifvdhdlevalerrlkr--------------------
00503742   2/2  qlsggerlrvalaeallalgkpdllilDEitnlldpetlspdvlelLlrlleegkltdkllgltliltth
00533501   1/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00515532   2/2  llglgdlldklpse...........lsgGqk---------------------------------------
00493432   2/2  fildpslelldeRlsgrdadtreeirkrlkrlleelgplieydyvivnddleealeelldiivvlllgli
00513761   1/2  ----------------------------------------------------------------------
00477972   2/2  lrgldep.ealdarleraleellelae.gfdvvivnhdleealelldr----------------------
00493431   1/2  ----------------------------------------------------------------------
00470732   2/2  lldlleelgrpvvviilttnrevlldral.rRpgrllldep..eldppdreerleilkrllkklgtvldv
00379261   1/2  ----------------------------------------------------------------------
00513762   2/2  adeillvddptsgldaetqleilelllelllklgipiilvlnKlDllseeglelvlelleellellpill
00498811   1/2  ----------------------------------------------------------------------
00489572   2/2  gsrdkgllgklkpetraelldllre..egttilvvth.ldeaeraDrvavldd......Gtpeellarpa
00392702   2/2  llDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvtviattnrpeeldpallrpgrfdr---
00464411   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00496572   2/2  vifldeppteeldeRlrkrl.......rlgdteevlehrleraeeladrlial-----------------
00356411   1/2  ----------------------------------------------------------------------
00406782   2/2  llDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgvtviattndleeld--------------
00477971   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00477012   2/2  tPGlgsvavvdqlsggqkqrvalarallknpdtlillvedandldtesda.lellkel------------
00499192   2/2  ildgptllldpe..........................lrpladlvifld--------------------
00356412   2/2  llgleykgdrdpee...........lsggqkqrval----------------------------------
00515512   2/2  lfdll............dglpselsggq------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00404192   2/2  llllDEidalgldpelqeellelldelaergvtlilttnnrpeeldqallr-------------------
00464412   2/2  dlvllldept------------------------------------------------------------
00468952   2/2  ..........................erllsggkpqlvviDsltalrpalllldeptge-----------
00510562   2/2  ..............eellalaerllsggkvdlvviDsltalapalelsllldeptsgldasllreilrll
00470731   1/2  ----------------------------------------------------------------------
00420942   2/2  llDEidklapkrsptsaldadvrrevlnaLlrlldglqalsnv---------------------------
00468951   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00405882   2/2  vlNKiDeptneldlellellee......lggtvvlvSahdgegldelldailellkgklv----------
00439861   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00498532   2/2  apslllldepgrvtqgldarllreilrllkrlakelgitvlltshvtrevedraddvpvlagggvlehla
00439862   2/2  lsgeellrvllalalelkpdlliiDeltalldaervrelrellralkrlakelgvtvilvsqlteli---
00508672   2/2  aiarplelaaepdlvi...dtsaldp--------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00513252   2/2  vvDet..gldraqrlellelardlgrpvlviflatspevlierlldrvllldegslvdlgvledl-----
00477011   1/2  ----------------------------------------------------------------------
00489632   2/2  dppdlvvfldapleellerllkRdgrteeeilerlarleery.............radlvivtddl....
00532472   2/2  slysrpavlllllyvdeplsgldvelreelrdlleslllvlplpdlvi----------------------
00437902   2/2  vddlsgyvge....lsggeklrellaealteavlkgkpsvlll---------------------------
00405881   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00432182   2/2  lalallreadvlllvvdadeptsfldle...llell----------------------------------
00394722   2/2  vlflDEidrlldardsesslevlnaLlrlledg...nv--------------------------------
00513251   1/2  ----------------------------------------------------------------------
00533152   2/2  pdlvifldapleelleRllkrgrlirleddseevlekrlerylklyerliepyeeaddvividasg.sie
00499332   2/2  dlvilldappeelleRllkrgrldgreddslellekrleryeeltrdlie--------------------
00508671   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00482722   2/2  epgllplpdlvifldappevlleRllkRg..gdseeeiekrleryreiaplleaadlvidndgsle----
00367292   2/2  flDEidalagkrgsgtsrldpevqnaLlrlleelrvlsgvlvi---------------------------
00480252   2/2  llvllldepllvldatagtellelakgllealgldgvvltkldlvaalgaalsvalilglpi--------
00402372   2/2  flDEidsllgarggsgvdpevqnaLlrlleeg..nvr---------------------------------
00386742   2/2  .kpgvlllDEida.ldpdvqeallelleegeltivggglltel---------------------------
00432181   1/2  ----------------------------------------------------------------------
00437922   2/2  ....................kpdvlllDEi.drldpda--------------------------------
00495772   2/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480442   2/2  evlleRllgrgddteevirkrlerl.........apeleyyeelgladvvivnddleealelllaillal
00521552   2/2  flDEidklapkrsptsglddvsrrrvlnaLlrllegledlsnv---------------------------
00461622   2/2  lavdpe.---------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00515352   2/2  fldapleelleRllkR..........ddseeeilerleryreeleplleeyddalvvidadg.sleevve
00416172   2/2  flDEidkl....dpdvqnaLlrvleegeltrl...gggivlpadvrlia---------------------
00437921   1/2  ----------------------------------------------------------------------
00473942   2/2  .akpgvlflDEidrl.drevqnaLlelleelqvtilggglvvv---------------------------
00420082   2/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00478082   2/2  ilDgfgrlldarqlleelllllleepppdlvifldadpevlleRllkRgrre------------------
00478081   1/2  ----------------------------------------------------------------------
00496062   2/2  fldapleelleRllkrgrllereddseevlekrlerylelyerliepykkadyvivid------------
00527262   2/2  glsggdleelleelaellkklgkpvililDEiqslldvsskelle-------------------------
00511382   2/2  iliDE.aqfldp...evvevlleladtgilvlvtglemdfage---------------------------
00476072   2/2  pdvlildgpl.lldvellplpdlvifldappevlleRllkRggdsleeie--------------------
00437901   1/2  ----------------------------------------------------------------------
00457852   2/2  ifldapleelleRllkrgreplddteevilkrlerlrelyerli.....epyeeaddvividas.lsiee
00499331   1/2  ----------------------------------------------------------------------
00430122   2/2  llDEidkl.dpdvlnaLlqlleegevtdlggrvvdlsnvivia---------------------------
00386741   1/2  ----------------------------------------------------------------------
00472912   2/2  kvvild..gtglsreareellellkelg.pvlvifldadpevlleRllkrgrallreevldrllevrepy
00527261   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00418302   2/2  gigllaladpgvlflDEidkllpargssggdv--------------------------------------
00487062   2/2  egkvvilDrepdsadlafagagyllggldleevkaleell................lvlpkpdlviyld.
00420081   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00478392   2/2  vildgtnlseal----------------------------------------------------------
00482662   2/2  GPpGtGKTtlakalanel...ggpvi.....................-----------------------
00472911   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00516042   2/2  pdl-------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00517692   2/2  llDtP-----------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00469162   2/2  llld------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  llDtPGlidfaseptnlldleiie----------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00497572   2/2  .................................................---------------------
00482661   1/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  arylrgadgillvvdatdglsfeevaklleellglaglegv-----------------------------
00493172   2/2  villd-----------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  .kapg-----------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  ifldaplev-------------------------------------------------------------
00519582   2/2  ildeptvgldskd---------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  anpgvlflDEidrlplkrqaggdllrallealltlldglislpsnvrvia--------------------
00480502   2/2  vildg-----------------------------------------------------------------
00486922   2/2  ifl-------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00501942   2/2  lldeidellek-----------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00509892   2/2  liEgagllplpliellrd----------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  dpdviilDelpgtnlklqdletlssvaktlnfpdyvvvltvd----------------------------
00512061   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00486892   2/2  eqaellrellkelglppdlvif------------------------------------------------
00482552   2/2  ..........gkvdlvviDslallarael..ldepllgldarelrellrlLkrlakelgvtviltsq---
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  sdtpgt----------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00378842   2/2  eearalakelgiplf..etSaktgegvde-----------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00476652   2/2  lerlgklalagggtvlflDEidkl.dpdvqnaLlrlleeppsn---------------------------
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00474202   2/2  ........................fllakpgvlflDEidkl.d---------------------------
00453762   2/2  ----------------------------------------------------------------------
00360951   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  ellgllllegvpillvgnKlDlpt----------------------------------------------
00373851   1/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  vvfilppspevllerlkkRgteseee--------------------------------------------
00463152   2/2  iaralsvvldllvldeplvglqrrlagrrgivadgrdigtvvfpdaelvkllleasleeradrvlvvivs
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:1400
query           YELVHMQSLGKTH---------------------------------------------------------
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00490802   2/2  tHdlsealladri---------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00510252   2/2  lvtHdlseallad---------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00379582   2/2  eellenpgll------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00509432   2/2  gGekqr----------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00482202   2/2  ytllllgeel------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00458602   2/2  peellenplllytll-------------------------------------------------------
00530592   2/2  riveegtpe-------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00378982   2/2  eellen----------------------------------------------------------------
00482262   2/2  ytllllsslpg-----------------------------------------------------------
00422811   1/2  ----------------------------------------------------------------------
00420702   2/2  ellenpa---------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00475892   2/2  gllaall---------------------------------------------------------------
00440862   2/2  rg.-------------------------------------------------------------------
00475992   2/2  iveegt----------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00500442   2/2  kslytaal--------------------------------------------------------------
00425572   2/2  paslyta---------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00502742   2/2  llytllllgsl-----------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00404102   2/2  eelle-----------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00468692   2/2  vllvthdls.------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00468602   2/2  pfe-------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00485452   2/2  gdivelgepqe-----------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00485932   2/2  gt--------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00448932   2/2  tpe-------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00422142   2/2  .---------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00469452   2/2  e---------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00368502   2/2  GqkqRva---------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00475372   2/2  akgga-----------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00488522   2/2  adrvl-----------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00490732   2/2  e---------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00379962   2/2  .---------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00379262   2/2  ggqrqrva--------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00533502   2/2  veeile----------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00487022   2/2  ergepldlleevl---------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00503742   2/2  dldller---------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00470732   2/2  thddelarladr.---------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00513762   2/2  lgv-------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00489572   2/2  npyvrellga------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00510562   2/2  k---------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00498532   2/2  d---------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00489632   2/2  .....e----------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00533152   2/2  e---------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00515352   2/2  eilalleellk-----------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00457852   2/2  vvee------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00472912   2/2  ell-------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00487062   2/2  ...adpeelleRlkk-------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00378842   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00373852   2/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00360951   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00373851   1/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00463152   2/2  dgRl------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00503162   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00503161   1/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00360952   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00378841   1/2  ----------------------------------------------------------------------