[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cimm2:CIRT_10408


[Show Plain Result]

## Summary of Sequence Search
   1::221
   3::141  9.7e-34 43.2% 0052861 00528611 1/1   binding domain-like                     
   6::141  1.1e-33 43.4% 0047248 00472481 1/1   binding domain-like                     
   3::129  1.5e-33 46.5% 0048340 00483401 1/1   binding domain-like                     
   2::141  4.4e-33 41.7% 0046856 00468561 1/1   binding domain-like                     
   3::139  4.8e-33 42.3% 0046232 00462321 1/1   binding domain-like                     
  12::141  1.3e-32 33.1% 0048600 00486001 1/1   binding domain-like                     
   6::130  1.1e-31 46.7% 0048882 00488821 1/1   binding domain-like                     
  14::141  2.5e-31 39.8% 0048492 00484921 1/1   binding domain-like                     
   5::138  3.8e-31 44.8% 0051666 00516661 1/1   binding domain-like                     
   6::133  2.6e-29 42.7% 0048512 00485121 1/1   binding domain-like                     
   3::129  5.3e-29 47.5% 0050263 00502631 1/1   binding domain-like                     
  24::134  3.8e-28 44.5% 0052199 00521991 1/1   binding domain-like                     
   3::121    6e-28 44.9% 0046231 00462311 1/1   binding domain-like                     
   6::121  1.5e-27 45.7% 0050530 00505301 1/1   binding domain-like                     
   6::121  6.4e-27 45.9% 0048339 00483391 1/1   binding domain-like                     
   4::116  6.5e-24 41.3% 0048513 00485131 1/1   binding domain-like                     
 142::223  1.7e-19 37.0% 0052860 00528601 1/1   ed helix" DNA-binding domain            
 142::221  1.8e-19 40.5% 0052198 00521981 1/1   ed helix" DNA-binding domain            
 142::220  2.2e-19 39.2% 0048601 00486011 1/1   ed helix" DNA-binding domain            
 142::220  2.5e-19 40.5% 0037767 00377671 1/1   ed helix" DNA-binding domain            
 142::213  4.2e-17 40.8% 0038753 00387531 1/1   ed helix" DNA-binding domain            
 139::217  1.3e-14 41.1% 0051665 00516651 1/1   ed helix" DNA-binding domain            
 148::211  0.00056 21.9% 0045862 00458621 1/1   ed helix" DNA-binding domain            
   1::221


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDNDAPLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAIMG
00528611   1/1  --rklplfsglseeelealldllevrtykkgevifreGdpadslyiilsGkvkvykldedgreqilailg
00472481   1/1  -----PlFsglseeeleallslleertfpkgevifrqGdpadslyiilsGevkvykldedgkeqilaflg
00483401   1/1  --rkvplfsglseeelealadalelrrfpagevifreGdpgdslyiilsGevevlkklsedgkevvlail
00468561   1/1  -LkkvplfsglseeelelllslarlrtfpkgevifregdeadglyivlsGrvrvy.lsedgreiilailg
00462321   1/1  --kkvplfsglseeelekladlleertfkkgevifreGdpadslyiilsGevevyklselllllldgkev
00486001   1/1  -----------sdeelklllksllkikkfkkgeiifkegdpadylyfllsGivklykisenGkelilsfl
00488821   1/1  -----plFsnlseelleklalllkertfkpgevifreGdpgdslyfilsGevevyk...dgk..vlatlg
00484921   1/1  -------------eelelllsalevrtfkkgevifrqgdpadslyivlsGrvkvyklsedGkelilailg
00516661   1/1  ----vplFkglseeeleklldalslklrkykkgevifreGdpadslyfilsGevkvvktdedgkevilav
00485121   1/1  -----aedeillklpkslrselllelllkllkkiplfsnlseeeleelasllkertfkpgevifreGdpa
00502631   1/1  --rkvplfsglseeelealaaalklrtfpagevifreGdpgdslyiilsGevevlk...dg....lavlg
00521991   1/1  -----------------------evrsfkkgevifregdldpadslyivlsGlvkvykldedgrevilal
00462311   1/1  --rkvplfsglseeelekladaleertfkkgevifreGdpgdslyiilsGevevyk.nedgkevvlatlg
00505301   1/1  -----plFsglseeelealadalkprtfkkgeviireGdpgdslyfilsGevevyktdgedgkevvlatl
00483391   1/1  -----plfsglseeeleeladaleevtfppgevifreGdpgdslyiilsGevevyk...dgk..vlatlg
00485131   1/1  ---slkelelllkllkkiplfsnlseeeleklasllkertflkpgevifregdpadslyiilsGevevyk
00528601   1/1  ----------------------------------------------------------------------
00521981   1/1  ----------------------------------------------------------------------
00486011   1/1  ----------------------------------------------------------------------
00377671   1/1  ----------------------------------------------------------------------
00387531   1/1  ----------------------------------------------------------------------
00516651   1/1  ----------------------------------------------------------------------
00458621   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           PGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVARGLLAQLAGRLRKANDVVADLVF
00528611   1/1  pGdlfGelalltgeprsatavAledsevlvipredflelleenpelalallrllarrlrrllerllllal
00472481   1/1  pGdffGelalltsgeprsatvvAltdsellvipredflelleenpelalallrllarrlrrllerlllla
00483401   1/1  gpGdffGelalltgeprtatvvAltdvellvldredflelleenpelalrllrllarrl-----------
00468561   1/1  pGdlfge.......prsataeAledtevlvipreafeellaenpelalallkllarrlrrllrliedlaf
00462321   1/1  vlatlgpGdlfGelalltgeprtatavAledsellvldredflelleenpelalrllrllarrlrqlle-
00486001   1/1  kegdlfgelslltntpypalltavaledtevlvipredfeelllknpelllyllkllskrlllleerlln
00488821   1/1  pGdffGelalltgeprtatvrAltdtellvlsredflellkeypelaekllrllaqrlrn----------
00484921   1/1  pgdlfgelallsgeaprpatavAledsellvipreaflelleedpelalallrllaerlrlllerleela
00516661   1/1  lgpgdffGelallllgtprtatviAltdvellvldredflelleeypelalkllrllaerlrllnrrl--
00485121   1/1  dslyiilsGevevyklsedslgkeqilailgpGdifGe.alltgeprtatavAltdtellvip-------
00502631   1/1  pGdffGelalltgeprtatvvAltdvellvlpredflelleeypelalallrllarrlr-----------
00521991   1/1  lgpGdffGelallgg.prtatavAltdvellvlpredflellaenpelalallrllarrlrele------
00462311   1/1  pgdlfGelalltgeprtatvvaltdsellvldredflrlleenpelalrll-------------------
00505301   1/1  gpGdffGelalllllessllntneprtatvrAltdvellvldredflelle-------------------
00483391   1/1  pGdlfGelalltgeprtatvvaltdtellvldredflelleenpelalrll-------------------
00485131   1/1  ....gkevvlailgpGdlfGelalltgeprtatavaledsvellvi------------------------
00528601   1/1  ----------------------------------------------------------------------
00521981   1/1  ----------------------------------------------------------------------
00486011   1/1  ----------------------------------------------------------------------
00377671   1/1  ----------------------------------------------------------------------
00387531   1/1  ----------------------------------------------------------------------
00516651   1/1  --------------------------------------------------------------------al
00458621   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRETVNKALADFASRGWLRLEPRSVVI
00528611   1/1  k---------------------------------------------------------------------
00472481   1/1  l---------------------------------------------------------------------
00483401   1/1  ----------------------------------------------------------------------
00468561   1/1  k---------------------------------------------------------------------
00462321   1/1  ----------------------------------------------------------------------
00486001   1/1  l---------------------------------------------------------------------
00488821   1/1  ----------------------------------------------------------------------
00484921   1/1  l---------------------------------------------------------------------
00516661   1/1  ----------------------------------------------------------------------
00485121   1/1  ----------------------------------------------------------------------
00502631   1/1  ----------------------------------------------------------------------
00521991   1/1  ----------------------------------------------------------------------
00462311   1/1  ----------------------------------------------------------------------
00505301   1/1  ----------------------------------------------------------------------
00483391   1/1  ----------------------------------------------------------------------
00485131   1/1  ----------------------------------------------------------------------
00528601   1/1  -saeeRlaalLlllaerlg.llldgilitlpltreelAdllgltretvsrlLsklekeglielegrrili
00521981   1/1  -sveeRlarlLlllaerlgllg.dgllillpltqeelAdllgltretvsrlLskLekeglielergriti
00486011   1/1  -svegRlaslLlllaerlgvrtpdgillinlpltqeelAellGlssretvsrvLskLkkeglievdggki
00377671   1/1  -dveeRlarlLlllalrlglrlgdgllidlllteeeLAellgvsretvsraLkeLekeglielrrgrgiv
00387531   1/1  -saeeRlarlLlllaerlglllgsgi.illpltqeelAellglsretvsrvLkkLekeglieleggriti
00516651   1/1  lsveeRlarlLllladrlgsl......ltlpltqeelAdllglsretvsrlLkkLeeeglieldrgrili
00458621   1/1  -------lleltelledylklillllledgplsvseLaerlgvspptvsralkrLeedGlvererdggdr


                         -         -         -         +         -         -         -:280
query           MDIERMARRAR-----------------------------------------------------------
00528611   1/1  ----------------------------------------------------------------------
00472481   1/1  ----------------------------------------------------------------------
00483401   1/1  ----------------------------------------------------------------------
00468561   1/1  ----------------------------------------------------------------------
00462321   1/1  ----------------------------------------------------------------------
00486001   1/1  ----------------------------------------------------------------------
00488821   1/1  ----------------------------------------------------------------------
00484921   1/1  ----------------------------------------------------------------------
00516661   1/1  ----------------------------------------------------------------------
00485121   1/1  ----------------------------------------------------------------------
00502631   1/1  ----------------------------------------------------------------------
00521991   1/1  ----------------------------------------------------------------------
00462311   1/1  ----------------------------------------------------------------------
00505301   1/1  ----------------------------------------------------------------------
00483391   1/1  ----------------------------------------------------------------------
00485131   1/1  ----------------------------------------------------------------------
00528601   1/1  ldldaLrklagld---------------------------------------------------------
00521981   1/1  ldleaLrelae-----------------------------------------------------------
00486011   1/1  iildldaLke------------------------------------------------------------
00377671   1/1  vldldaLrel------------------------------------------------------------
00387531   1/1  ldl-------------------------------------------------------------------
00516651   1/1  ldleaLe---------------------------------------------------------------
00458621   1/1  l---------------------------------------------------------------------