[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB80033.1


[Show Plain Result]

## Summary of Sequence Search
   1::171
   2::142  PF02502 0.0% 47.8571428571429  Ribose/Galactose Isomerase 
   1::171


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKIAIGCDHIVTDTKIAVSDFLKAKGYDVLDVGTYDFTRTHYPIFGKKVGEAVASGEADLGVCICGTGVG
PF02502         -kiaigsDhaglelkeaivehlkekgievvdvGtksaesvdYpdyaikvaeavasgeadlgiliCgtGiG


                         -         -         *         -         -         -         -:140
query           INNAVNKVPGIRSALVRDMTTAIYAKEQLNANVIGFGGKITGEFLMCDIIEAFIKADYIENEENKKIINK
PF02502         msiaaNkvkgirAalvhdeesAelarehnnanvlalgarltgpelakkivdafletefe.ggrhakrvdk


                         +         -         -         -         -         *         -:210
query           INSLEENKPEQNDIHFFDEFLERWNRGEYKD---------------------------------------
PF02502         ik--------------------------------------------------------------------