[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB80140.1


[Show Plain Result]

## Summary of Sequence Search
   1::162
  83::160  PF00583 0.0% 35.0649350649351  Acetyltransferase (GNAT) family 
 104::161  PF08445 0.0% 32.7586206896552  FR47-like protein 
   1::162


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MESKENSKKSSEAKNKLEKIYSTSLPDGYRFTDFRIGDENNWAYIQYSAGVFKDYQLAIRRIFKEENSLK
PF00583         ----------------------------------------------------------------------
PF08445         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GNFKNRCVFLENENGERIGTIMIVPSLSEEEGVQEIKYLALLPKYQEQGLGKLLISKAYKMVDDVEGATR
PF00583         ------------edgelvGfaslsvigedgraertayieglaVspeyrgqGiGkaLleallekare.rgl
PF08445         ---------------------------------gelgalqvlpehrrrGlgsrlvkalakeiaergktvl


                         +         -         -         -         -         *         -:210
query           INLEAYNDKSIVLFENLGFERS------------------------------------------------
PF00583         erielevesgndraiklYek--------------------------------------------------
PF08445         lvvvasNtpsirlyeklGfek-------------------------------------------------