[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB80292.1


[Show Plain Result]

## Summary of Sequence Search
   1::248
  77::227  PF00455 0.0% 41.0596026490066  Bacterial regulatory proteins, deoR family 
   6::59   PF08220 0.0% 55.5555555555556  DeoR-like helix-turn-helix domain 
   7::47   PF08279 0.0% 39.0243902439024  HTH domain 
   1::248


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLSEKRHEIILNLLKLKGFVSLTELLEATESSESTIRRDLSYLESINLLKRVHGGAKSLANVSKELSYNE
PF00455         ----------------------------------------------------------------------
PF08220         -----RieqilellkqqgklsveelvellgvSeaTiRRDLneLeeqglltRthGGavsi-----------
PF08279         ------lqilelLlqarepvsgeeLAeeLnVSrrtirrdIkaLeelg-----------------------


                         -         -         *         -         -         -         -:140
query           KSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEGKDILVVSNGLSHIDTLIQKNIKCYVIG
PF00455         ------eeKrkIAkkaaeliedgdtifldaGtTvlelaeelakeknltvitnslnvanaLsekehvevil
PF08220         ----------------------------------------------------------------------
PF08279         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTTPDTEEAILKECAINNSRKAYVLADDSKF
PF00455         iGGelreksesfvgelaesflekfridklflsasgidleggltesdleeaevkkailerarevlLlvDhS
PF08220         ----------------------------------------------------------------------
PF08279         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GEISTIKFSDINKCVIITNEKPKDNTYDKKTDIKVVDI--------------------------------
PF00455         Kfgksslvrladlsqvd-----------------------------------------------------
PF08220         ----------------------------------------------------------------------
PF08279         ----------------------------------------------------------------------