[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB80503.1


[Show Plain Result]

## Summary of Sequence Search
   1::193
  64::173  PF01569 0.0% 31.8181818181818  PAP2 superfamily 
   1::193


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNFWNDIFNSINGLAGKNHLLDSIMLFSSKRLPYILFATVIVVYLIGIISKNKKARGIAVDTIVFTGINL
PF01569         ---------------------------------------------------------------lalalaa


                         -         -         *         -         -         -         -:140
query           ILAVIVGHFFYAPRPFVNDPNAKLLYPHKPDSSFPSGHSVGSMSIALGLNRYNKALGTICVILSILMGIS
PF01569         listvlKalfgrpRPdvlarddilldptegkaslfpsfPSgHaafafaaalllalllkrklgkrvllall


                         +         -         -         -         -         *         -:210
query           RVYVGHHYPQHVVASFLIVIILNVLYMKFLSKSVQKLYFSIEKHIPILNKLVK-----------------
PF01569         llilallvalsRvylgvHfpsDvlaGlllgili-------------------------------------