[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB80582.1


[Show Plain Result]

## Summary of Sequence Search
   1::147
  59::134  PF00583 0.0% 22.3684210526316  Acetyltransferase (GNAT) family 
   1::147


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSNIYEFKKEDLNECAELFVKTFSKEPWNEPWDFENAKKRLNDVVLTPGFRGAVLRNDEKIEGVILGNLE
PF00583         ----------------------------------------------------------gelvGfaslsvi


                         -         -         *         -         -         -         -:140
query           QWYDGEHFCVKEFFVDSSSQGKGTGKKLLNALEDILMEKEVGVIHFWTMKGSTAEAFYNKRGYEIPKELI
PF00583         gedgraertayieglaVspeyrgqGiGkaLleallekarerglerielevesgndraiklYekl------


                         +         -         -         -         -         *         -:210
query           MMRKKLK---------------------------------------------------------------
PF00583         ----------------------------------------------------------------------