[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB80734.1


[Show Plain Result]

## Summary of Sequence Search
   1::113
   8::101  PF02641 0.0% 41.4893617021277  Uncharacterized ACR, COG1993 
   1::113


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRNEFKGSFLKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEGLDSHHKIHSDFIEILARNLPI
PF02641         -------kllriytseadkfEGkplykalveklkeegirGAtvlrgiaGyGkkkevhsedlfrLsvelPv


                         -         -         *         -         -         -         -:140
query           VIEVIESKEKINELIELIEPMIETGTITVIDNIQVISLNKKTD---------------------------
PF02641         vvevvdeeekikrvleeikeliknglitled---------------------------------------