[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81021.1


[Show Plain Result]

## Summary of Sequence Search
   1::301
 109::293  PF07478 0.0% 39.1304347826087  D-ala D-ala ligase C-terminus 
   1::45   PF01820 0.0% 46.6666666666667  D-ala D-ala ligase N-terminus 
  50::84   PF01820 0.0% 48.5714285714286  D-ala D-ala ligase N-terminus 
  94::271  PF08443 0.0% 27.3809523809524  RimK-like ATP-grasp domain 
 120::263  PF02655 0.0% 26.865671641791  ATP-grasp domain 
  94::190  PF01071 0.0% 30.5263157894737  Phosphoribosylglycinamide synthetase, ATP-grasp (A) 
  94::186  PF02786 0.0% 25  Carbamoyl-phosphate synthase L chain, ATP binding d 
 106::176  PF02222 0.0% 27.9411764705882  ATP-grasp domain 
   1::301


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTV
PF07478         ----------------------------------------------------------------------
PF01820         lkvavlfGGrSsEheVSlkSakavlkaLdkekyevvpigitkegk----kekvdvvfpvlHGknGEDGti
PF01820         lkvavlfGGrSsEheVSlkSakavlkaLdkekyevvpigitkegk----kekvdvvfpvlHGknGEDGti
PF08443         ----------------------------------------------------------------------
PF02655         ----------------------------------------------------------------------
PF01071         ----------------------------------------------------------------------
PF02786         ----------------------------------------------------------------------
PF02222         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QSVLKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNG
PF07478         --------------------------------------vapfivlekeeakkeklekvveklgypvfvKp
PF01820         qgllellgipyvGs--------------------------------------------------------
PF01820         qgllellgipyvGs--------------------------------------------------------
PF08443         -----------------------dKlkslklLakkkikvpktalarseedae.kliekikqfPvvvKsvf
PF02655         -------------------------------------------------kleaeeleeeekklvvKprdG
PF01071         -----------------------sKsfakdllkkagiptaeyeaftdpeeak.eyieeatakalVvKadg
PF02786         -----------------------Dkesakealkkinvpvvpssaapvetlee.alaiakeigyPviikaa
PF02222         -----------------------------------glpvprflaveskeele.eaveelglpvvvKarrl


                         +         -         -         -         -         *         -:210
query           GSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAIKPKGKFFDIASKYGD
PF07478         areGSSvGiskveseeeleeaieeafqydekvlveeaiegreievavlgneklevsevgeivlkkgfydy
PF01820         ----------------------------------------------------------------------
PF01820         ----------------------------------------------------------------------
PF08443         gsqGikvvlaedkqsleq.lleafkqlkeailvQefIeeaenrdiRvlVvgdev..vaalervskeGdfr
PF02655         aGgesvrvvenkeeaeealeele......vvqefieGeplSvsvlsdgekvlllavnrqlieleekkfvy
PF01071         laagKgvivakseeealkavkeile.kkkfGeagekvviEelleGeEvsv--------------------
PF02786         fglGGkGmrvardeeelaelvkkalaeakaafgnkqvlvekslkgp------------------------
PF02222         gydGkGqsvvkseeeleqaleal..keeklivEefv----------------------------------


                         -         -         -         +         -         -         -:280
query           GGADEFIVELNEDLHKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTLPGMTKNSLFPKSAAGI
PF07478         eekyelid.ssaeievpakleeeveekikelakkaykalglkGlaRvDfflteegeivlnEvNtlPGfTs
PF01820         ----------------------------------------------------------------------
PF01820         ----------------------------------------------------------------------
PF08443         sNlarGgvaekl.....qlseeeeelaikaaeameld.vlgvDileskrgllvlEvNssvg---------
PF02655         aGnltpietelkeelvelaeev....vealegllGyvGvDlvlkdeepyviEv-----------------
PF01071         ----------------------------------------------------------------------
PF02786         ----------------------------------------------------------------------
PF02222         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           NMSFEELLDTIIEKSLKVNRE-------------------------------------------------
PF07478         iSlypklaaaaGl---------------------------------------------------------
PF01820         ----------------------------------------------------------------------
PF01820         ----------------------------------------------------------------------
PF08443         ----------------------------------------------------------------------
PF02655         ----------------------------------------------------------------------
PF01071         ----------------------------------------------------------------------
PF02786         ----------------------------------------------------------------------
PF02222         ----------------------------------------------------------------------