[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81084.1


[Show Plain Result]

## Summary of Sequence Search
   1::303
  12::272  PF04018 0.0% 37.1428571428571  Domain of unknown function (DUF368) 
   1::303


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MYVINFIRGFLMALADSVPGVSGGTIAFIMGFYNKFISSLNALTSTKKTDVSKKDAIIFLLKLGIGWITG
PF04018         -----------mGaAdvvPGvSGGtiAlilGiYerLieaikslnakalklllkeqlkaalkkidlkfLlt


                         -         -         *         -         -         -         -:140
query           MVLSILFIASIFDKEIYKISSLFTGFIIFSIPIIISEDKESLKKNYGYIIYAILGIAIVAAITYFNPATG
PF04018         lvlGivlsilllsklieyllenypiltlsfFlGlilasvvvlike...vkkksllkilllllglvialll


                         +         -         -         -         -         *         -:210
query           SAKGTSLVLNEFSLPLALYVFFAGMIAISAMVLPGISGSTLLLIFGLYAPVVNGVKEVLTFNFSYLPMLM
PF04018         tl.........lssatakksleetllvlfiaGaiaicamilPGiSGSflLlllgvYelvlaavselvk..


                         -         -         -         +         -         -         -:280
query           VFGLGVVVGIITTIRLIKFLLSNYRSQMIYFIIGLMIGSIYAVFMGPTTLEIPKAAMNLSSFNFLFFIIG
PF04018         lealavllvfalGaviGlllfsrllsalLkkyrdatlavliGlvlgslrkvw..Pwksaaea--------


                         -         *         -         -         -         -         +:350
query           GALILGLQQLKGYLEKKEKVSNI-----------------------------------------------
PF04018         ----------------------------------------------------------------------