[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81104.1


[Show Plain Result]

## Summary of Sequence Search
   1::235
  15::218  PF01048 0.0% 32.3529411764706  Phosphorylase superfamily 
   1::235


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSIHIGAKEGQIAETILLPGDPLRAKFIAETFLENPVCYNEVRGMLGYTGTYKGKRISVQGTGMGVPSIS
PF01048         --------------iaiivgspgevallaespleetpygregrggkfvtGtlkgkpvvlvstGiGkpnaa


                         -         -         *         -         -         -         -:140
query           IYVNELIRDYGVKNLIRVGTAGGMQEDIKVRDLVLAMSSHTDSAINKVRFNGLDFAPTASFKLLKAAYDT
PF01048         viatarllkefgvkaiirtGtaGglnpdlkvGdvvipddainfdgtsplygpkeegegapdvaeakadpe


                         +         -         -         -         -         *         -:210
query           AVEKGYSPKVGSVFTADSFYNDNPEAWKQWAKFGTLAVEMETAALYTLAAKYGVNALTILTISDHLITAE
PF01048         llallkeaaealgikvhrGvvatgdgfyaeteaelrllrrlgadaveMEtaavaqvArelgvpfaairvv


                         -         -         -         +         -         -         -:280
query           ETTSEERQTTFTKMMEVALDAAITL---------------------------------------------
PF01048         sDlaagga--------------------------------------------------------------