[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81143.1


[Show Plain Result]

## Summary of Sequence Search
   1::400
   8::150  PF05201 0.0% 34.7517730496454  Glutamyl-tRNAGlu reductase, N-terminal domain 
 172::289  PF01488 0.0% 33.8983050847458  Shikimate / quinate 5-dehydrogenase 
 306::398  PF00745 0.0% 25.8064516129032  Glutamyl-tRNAGlu reductase, dimerisation domain 
   1::400


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIGVIGVKRNVDIAIREKLALYPKKHKKYVGELLNSFKEVVILNTCNRTEIYFNCTEEISEDEIFDKIFN
PF05201         -------nhktapvelreklafseeeleealaqlkeeegieevvilsTCnRtEiylasedaeaaveelse
PF01488         ----------------------------------------------------------------------
PF00745         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VFNWNDDLKKYMFLSKEKRAVTHLMEVICGFHSRILGEDQILGQIKDAYKTAISDNSISSELQKMFEIAI
PF05201         llae.fkqlslee.leeylyvlegeeavrhlfrVasGLdSmvlGEpqIlgQvkrAyelakeagtlgkiLe
PF01488         ----------------------------------------------------------------------
PF00745         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ACGKKFKTECKMFEVPVSSVSISINSALLKGCRKFMVLGYGEIGKLAIKHLLSHKVECIYLIVRDKSKAS
PF05201         rlfqkafava------------------------------------------------------------
PF01488         -------------------------------gkkvlviGAGemarlvakhLlekgvkkiviaNRtaekak
PF00745         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DLEGEIVEVLDFNEKNQVINEVDCIVSCTAAPHTVVRNEDIKTEGDIIHIYDLAVPRDVDKELSEKERVI
PF05201         ----------------------------------------------------------------------
PF01488         eLaeelggeevealpleeleellaeadvvisatsapepiiekeaveeakkklgllvDiavPRdvepevae
PF00745         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LKDIDEISKIDDKNKKIRKERMEEYKHIVEESIEEFLNWLKIREVSSKIRNIKIRENEICSERIKTFSNK
PF05201         ----------------------------------------------------------------------
PF01488         ledvrvynv-------------------------------------------------------------
PF00745         -------------------------eaIIeeeveefeewlkslevvplIralrekaeeireeelekalkk


                         -         -         -         -         *         -         -:420
query           GNGENAKLAERMIKSTADAYVNRAIELLKSEALKGSDSSCAEIIEKIFLT--------------------
PF05201         ----------------------------------------------------------------------
PF01488         ----------------------------------------------------------------------
PF00745         lalgedpeevleklarsltnkllhaptkalreaaadgdadellealrr----------------------