[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81144.1


[Show Plain Result]

## Summary of Sequence Search
   1::326
 101::300  PF01077 0.0% 28.9855072463768  Nitrite and sulphite reductase 4Fe-4S domain 
  21::81   PF03460 0.0% 36.0655737704918  Nitrite/Sulfite reductase ferredoxin-like half doma 
 147::153  PF00037 0.0% 42.8571428571429  4Fe-4S binding domain 
 169::186  PF00037 0.0% 38.8888888888889  4Fe-4S binding domain 
 200::221  PF00037 0.0% 59.0909090909091  4Fe-4S binding domain 
   1::326


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSLDINTKKLKKNAFRVTKRRGYTASRIRVPGGHLDAKLLLNIQEIADTYGDGTVHITTRQGFEIPGIDM
PF01077         ----------------------------------------------------------------------
PF03460         --------------------kgyymvrlrvpnGritaeqlraladiaekygsgeirlTtrQnlqlhgvpe
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KDIPEVNKKLQPIIEALEINQENPGDGYNAAGTRNVSACIGNNVCPFANYNTTNFAKKIEKAIFPNDLHF
PF01077         ------------------------------anlrnvklcpgaglceeallDttelakaledeledeygrt
PF03460         edleeileeLa-----------------------------------------------------------
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KIALTGCPNDCIKARMHDFGIIGMTEPQYERNRCVSCGACVRACKKKATGALSFENFKVVRDGSKCIGCG
PF01077         alPrKfKiavsgcpnncvaveanDigivgvekdeiei.................................
PF03460         ----------------------------------------------------------------------
PF00037         ------CPvgAIe---------------ideekCigCGaCvevCPv-------------videekCigCG
PF00037         ------CPvgAIe---------------ideekCigCGaCvevCPv-------------videekCigCG
PF00037         ------CPvgAIe---------------ideekCigCGaCvevCPv-------------videekCigCG


                         -         -         -         +         -         -         -:280
query           ECVMNCPTNAWTRSKEKYYRLAIMGRTGKKNPRLAEDFILWVDEDSIIKIILNTYKYVTEYIAKDAPGGK
PF01077         .......................gfnilvGGkmgrthgaaktlarlgfvpeedvievveaivevyr....
PF03460         ----------------------------------------------------------------------
PF00037         aCvevCPvgAI-----------------------------------------------------------
PF00037         aCvevCPvgAI-----------------------------------------------------------
PF00037         aCvevCPvgAI-----------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EHIGYIIDRTGFMEFKKWALEGVTLSEKALMKNNVYWSGIHYTNGF------------------------
PF01077         ..gdrknrkkeRlkylierl--------------------------------------------------
PF03460         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------