[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81145.1


[Show Plain Result]

## Summary of Sequence Search
   1::263
 107::207  PF00175 0.0% 29  Oxidoreductase NAD-binding domain 
 226::257  PF10418 0.0% 43.75  Iron-sulfur cluster binding domain of dihydroorotat 
  32::92   PF00970 0.0% 31.6666666666667  Oxidoreductase FAD-binding domain 
   1::263


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHNEYTPFISKILNVKKHTDIEYTFRMEFKGDVKPGQFFEVSLPKFGEAPISVSGIGEDYVELTIRRVGV
PF00175         ----------------------------------------------------------------------
PF10418         ----------------------------------------------------------------------
PF00970         -------------------------------glpvGqyvflrlpiegeevvRaYspassp.sekgelell


                         -         -         *         -         -         -         -:140
query           VTNEIFEKYEGDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIVDYFSQNPKDAESFTLISGFK
PF00175         ------------------------------------iaGGtGiaplrsvlkalled.edetkvvlvyGvr
PF10418         ----------------------------------------------------------------------
PF00970         vkvvpgGkmsqyldelkvgdtl------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GPKDILFKDDMKEWEKNMNMIITVDSAEEGYEGNTGLVTKYIPELEIKDMDNVQVIVVGPPMMMKFTVLE
PF00175         teedlllreeleelakklpgrlkvvavsrtddgwkggkgyvtdalleelleeeidkeetdvyvCGpp---
PF10418         ----------------------------------------------------------------------
PF00970         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FLKRGIKEENIWISQERKMCCGLGKCGHCKIDDTYICLDGPVFNYTKGKLLID-----------------
PF00175         ----------------------------------------------------------------------
PF10418         ---------------eerMaCGvGaCggCvvktkekdgykrvCkdGP-----------------------
PF00970         ----------------------------------------------------------------------