[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81146.1


[Show Plain Result]

## Summary of Sequence Search
   1::338
 221::235  PF00037 0.0% 60  4Fe-4S binding domain 
 303::316  PF00037 0.0% 50  4Fe-4S binding domain 
   1::338


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGLRLTKDNFDKIIDCLKKEYKIYAPKVMEGKGRFSDTDMTRYGEIDSINDIEFSKKSDFSYKEVLLPIT
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QTLFFFTEDKFSEASVEEKNILIFLRSCDMHSLRRIDDIYLRNGFEDPYYKKLREKAKFIVMGCENSFDN
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           CFCVSMGTNKTDEYSAYIGLDNDEVLLDIKDEELSKIFEAVESNKEEVSPKFVEENETKVEVPEGIDLNI
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           IKSTVWNEYSERCIACGRCNFVCPTCTCFTMQDVFYKDNENAGERRRVWASCQVDGYTDMAGGHSFRKDK
PF00037         ----------ekCigCGaCvevCPv---------------------------------------------
PF00037         ----------ekCigCGaCvevCPv---------------------------------------------


                         -         *         -         -         -         -         +:350
query           GQRMRFKVMHKVYDYKKRWGYHMCVGCGRCDDICPEYISFSECVNKLKDAVEEVKDNA------------
PF00037         ----------------------kCigCGaCvevCPv----------------------------------
PF00037         ----------------------kCigCGaCvevCPv----------------------------------