[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81193.1


[Show Plain Result]

## Summary of Sequence Search
   1::334
  66::269  PF09084 0.0% 24.3523316062176  NMT1/THI5 like 
  79::274  PF02621 0.0% 25.4237288135593  Putative periplasminc binding protein (DUF178) 
  63::112  PF00497 0.0% 17.7777777777778  Bacterial extracellular solute-binding proteins, fa 
  66::262  PF00497 0.0% 25.4335260115607  Bacterial extracellular solute-binding proteins, fa 
   1::334


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKLNKFLSLVLMVLFSLSILVGCNTSKKEEAKAPEEKTSIEIVVPDGLPAISIVKMIKEKPEIMKGLDI
PF09084         -----------------------------------------------------------------eGLdV
PF02621         ----------------------------------------------------------------------
PF00497         --------------------------------------------------------------k..krlgv
PF00497         --------------------------------------------------------------k..krlgv


                         -         -         *         -         -         -         -:140
query           NYSIVKGSDALVSKVLKGEGDICIVPSNVAAIAYNKEAKYKLAGTVGFGSLYVISSDDSVNSLEDLKGKD
PF09084         eilepadpsdavelvaagkadfgvsyqeslllarakglpvvavaallqeplnglivlkdsg.ikspkDLk
PF02621         --------etlnrallegeldvaliSsaayarladdyallpdlsiaalgrvlsvllvs....kvpleele
PF00497         klefvev.sfddlipalesgkvDiai.....aaisitpeRekkvdFsqpyftaglvilvrkkdakkissi
PF00497         klefvev.sfddlipalesgkvDiai.....aaisitpeRekkvdFsqpyftaglvilvrkkdakkissi


                         +         -         -         -         -         *         -:210
query           VYNVGQGLTPDLIFKILLQNDGINPEKDLTLSYVNAASELAPLFIEGKAKYAVVPEPMLTQIMTKKPETK
PF09084         Gkrigysgsef.ekallkallkkaGidps.dvtl..vnvggtslakalltgkvDaviggyenwegvele.
PF02621         kkrvalpgestTsvlLlklllaeay.ep....elvevp..deieeavlegedagllIGdeal...tyaee
PF00497         ksladLkgkkvg.vqagttaedllkeelkk.......gakvveyddleealaaLaagrvdavvadspvla
PF00497         ksladLkgkkvg.vqagttaedllkeelkk.......gakvveyddleealaaLaagrvdavvadspvla


                         -         -         -         +         -         -         -:280
query           IVASLNEQWKEMSDSKMGYPQSSVIVKEDLAKNNSEAVQKILKEIDNSTKWANENKEEAGAFAEEVGITG
PF09084         .....segkelnifaladlgvpdyyslvlitnektlkknpelvkkFlrAlkkGyeyala-----------
PF02621         glekvlDLgelWeelt..glPlvfglwvvrrdlae...eaakeleealresveyalkhpeeiae------
PF00497         ylvkknggkklvvv.........deplegeeyaiavrkg.dseLrkainkal------------------
PF00497         ylvkknggkklvvv.........deplegeeyaiavrkg.dseLrkainkal------------------


                         -         *         -         -         -         -         +:350
query           KKEIIAKSLERANLNYVSALDSESEYIKYYDKIYSLEPKAIGGKKVNEEIFLQK----------------
PF09084         ----------------------------------------------------------------------
PF02621         ----------------------------------------------------------------------
PF00497         ----------------------------------------------------------------------
PF00497         ----------------------------------------------------------------------