[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81206.1


[Show Plain Result]

## Summary of Sequence Search
   1::440
 334::422  PF02518 0.0% 22.3529411764706  Histidine kinase-, DNA gyrase B-, and HSP90-like AT 
   1::440


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLMNQMFWDFMENASMIIEWVSFYLIISQFSPKKRKNKQEVYSFIVIIIFSVLLKVLNVYPNERIVICFF
PF02518         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IGLIYYKFNFRVNNIKCIMISLIFWLFMLTVEALSISFIVKINSLVNVSDLLGKNIYRMETMILSKVILI
PF02518         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SLIMVVRCLKFRVDIGKGDFIYILTPIATNIIIILVIFGYAFKGGREGFGDNVSIFFVSILLLLSNMSLM
PF02518         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FIVSKIIKNNKLKLENEFIKDKLEMEYKYYSNLKDNQEKVKRLYHDIKNHIACIEGNNKETGIRKKYIDS
PF02518         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LNSEIDKLNLGFNTGNEVLDVILNNKREKCMENNISLKVFIDFSKVNFIEYFDICTIFSNCIDNAIEACK
PF02518         -----------------------------------------------------lrqivselvdNavkate


                         -         -         -         -         *         -         -:420
query           KIKDNNRYISLKGNCVNNFYVIKIENSKTNKIKKLNGDFLTDKKDKFLHGIGLKNIRLALEKYNGEIIIE
PF02518         es....geievrvkreegelvieVeDnGiGipeedlervfepffqtdddsrkvggtGlGlsivkklvell


                         -         -         +         -         -         -         -:490
query           PLDDKFILKMLIPINQEKEA--------------------------------------------------
PF02518         gg--------------------------------------------------------------------