[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81210.1


[Show Plain Result]

## Summary of Sequence Search
   1::337
 276::337  PF06725 0.0% 66.1290322580645  3D domain 
  40::80   PF03990 0.0% 41.4634146341463  Domain of unknown function (DUF348) 
  96::135  PF03990 0.0% 32.5  Domain of unknown function (DUF348) 
 150::227  PF07501 0.0% 48.7179487179487  G5 domain 
   1::337


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVNIKKLFSKENRNKTLALGLTGLVLVGGIVVFSMRKTLNVVVNGERTEIVTYKGTVQGALHDNGITLAP
PF06725         ----------------------------------------------------------------------
PF03990         ---------------------------------------tltvDGkertvwTtadTVedlLeelgitLkd
PF03990         ---------------------------------------tltvDGkertvwTtadTVedlLeelgitLkd
PF07501         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KDKVTPSLESKISKNETITINKAVNVKVKTEDGEKEIVSAEDNVEDMLKSEGISFDDDDKILPDKKESLK
PF06725         ----------------------------------------------------------------------
PF03990         eDkVsPslds---------------VtltvDGkertvwTtadTVedlLeelgitLkdeDkVsPsl-----
PF03990         eDkVsPslds---------------VtltvDGkertvwTtadTVedlLeelgitLkdeDkVsPsl-----
PF07501         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DGMNVEVVKVDVKKVTEVHPIEFTTEVKKDESKPQTYTEVLNDGQDGEKKVTRELVYENGKEVSNNVIQE
PF06725         ----------------------------------------------------------------------
PF03990         ----------------------------------------------------------------------
PF03990         ----------------------------------------------------------------------
PF07501         ---------vtekeeteteeipfeterkeDpsLpkGeekvvqeGkpGektvtyrvtyenGkevsrelvse


                         -         -         -         +         -         -         -:280
query           LVVKEPVNKEVVKGTKETQTLSRGGESINFKKKLSVKSTAYNHPLGSAEAYTASGMHVLRDPNGYSTIAV
PF06725         -----------------------------------------------------------------rsiAv
PF03990         ----------------------------------------------------------------------
PF03990         ----------------------------------------------------------------------
PF07501         evtkepvdeivkvGtke-----------------------------------------------------


                         -         *         -         -         -         -         +:350
query           DPSVIPLGTKLYVEGYGYAIAADTGGAIKGNRVDLFFNTEAEASNWGVRNLDVYILN-------------
PF06725         DpsviplGtlvlvegygldvekkpvsrlviaqDtGgaIkGnriDlfmGtgdeagala-------------
PF03990         ----------------------------------------------------------------------
PF03990         ----------------------------------------------------------------------
PF07501         ----------------------------------------------------------------------