[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81382.1


[Show Plain Result]

## Summary of Sequence Search
   1::796
 434::623  PF01580 0.0% 50.5263157894737  FtsK/SpoIIIE family 
 725::789  PF09397 0.0% 61.5384615384615  Ftsk gamma domain 
 467::508  PF00270 0.0% 35.7142857142857  DEAD/DEAH box helicase 
 461::508  PF01935 0.0% 40  Domain of unknown function DUF87 
   1::796


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAGGKKKTATKTQKKKNQSQIKVTEEIYALIAICVSLIVMFSLYTDKAGYLSVISRTLLIGLFGIGAFFI
PF01580         ----------------------------------------------------------------------
PF09397         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF01935         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           PIYIIYLCTKLFLFKREVLFSRIGLGITIALITSVLLIQTVNINDYYVQGSIWGSIKTIWHSQSEWHGGV
PF01580         ----------------------------------------------------------------------
PF09397         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF01935         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VGFLIVLPLYKLVGKIGLFVIFVTLYLISSMLIFDYNLVSIRNFFGGFKEKASKVKFVDKKYEKDDYINL
PF01580         ----------------------------------------------------------------------
PF09397         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF01935         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KKKDGASEGNKESKKDDISEDNNKIKILDFMKNSSLNDIEDNKKEKDNQLKDNIKINDFKQESKMPRDLS
PF01580         ----------------------------------------------------------------------
PF09397         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF01935         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LDNTIIEQRGFNSEKAKEEESIDKEISNNIASKGSSVGASYVAPNADLLNLNNNNELDKDDKKALLANAA
PF01580         ----------------------------------------------------------------------
PF09397         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF01935         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KLEETLMSFGVEAKILQVTKGPSVTRFELQPKAGIKVSKIVNLADDIALGLAAKGVRIEAPIPGKSAIGI
PF01580         ----------------------------------------------------------------------
PF09397         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF01935         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           EVPNKEQTPVFFREIVESKEFLDNKFKVACALGKDITGKAVVTDLSKMPHVLIAGATGSGKSVCINTLIV
PF01580         -------------ellegkparkeysrltialgkegsgkplvadlvkaphlLiaGatgsGKStflrtLil
PF09397         ----------------------------------------------------------------------
PF00270         ----------------------------------------------eggdvlvaaeTGsGKTlaflipvl
PF01935         ----------------------------------------vyldlnklvtrHlAilgsTGsGKSntvavL


                         *         -         -         -         -         +         -:560
query           SILYKYSPDEVKLLMIDPKVVELNVYNGIPHLLIPVVTDPKKAAAALNWAVNEMTRRYKLFADNGVRNIE
PF01580         slaathtPeevqlyliDpkggelaaledlphllsvavatdpekalraleelvaemeeRyallkqlgvrsi
PF09397         ----------------------------------------------------------------------
PF00270         qilyetlpnapkalivaP----------------------------------------------------
PF01935         leelle...kkgatilil----------------------------------------------------


                         -         -         -         *         -         -         -:630
query           SYNALYNKGEVPEKLPYIVIIVDELADLMMACPHDVEDYICRLAQMARAAGMHLVIATQRPSVDVITGVI
PF01580         eeydgeiaevpldgfagreleelpslvvivderaelrlaapkdssrrvedalsrlarkgraag-------
PF09397         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF01935         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           KANIPSRISFAVSSQIDSRTILDSAGAEKLLGRGDMLFYPVGESKPQRVQGAFISEEEVEHVVSFIKESQ
PF01580         ----------------------------------------------------------------------
PF09397         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF01935         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           RDAQYEEDILEHINSATIASEGNGDGDRDELLDEAIEIVVESGQASASYLQRRLRIGFNRAARIIEELEE
PF01580         ----------------------------------------------------------------------
PF09397         ------------------------eeeeDelydeavelVveqqkaSiSllQRrlriGYnrAarlieqlEe
PF00270         ----------------------------------------------------------------------
PF01935         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           CGVISRRDGSKPRQVLLSKDELENMK--------------------------------------------
PF01580         ----------------------------------------------------------------------
PF09397         egiVgpaegskpReVlvpk---------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF01935         ----------------------------------------------------------------------