[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81490.1


[Show Plain Result]

## Summary of Sequence Search
   1::142
   3::122  PF01592 0.0% 60  NifU-like N terminal domain 
   1::142


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIYSEKVMDHFKNPRNVGEIKDANGIGEVGNAKCGDIMRIYLKIENNIVEDVKFETYGCGSAIASSSMAT
PF01592         --ysdkvldhfknPrnvGvleeadagvgevgapacGDalrLqlkvdeetdriedakFktfGCgsaiAsss


                         -         -         *         -         -         -         -:140
query           ELIKGKTVEEAWELSNKAVAEALDGLPPVKMHCSVLAEEAIHKAINDYRQRQGLEPWDMKEHSHDIHEHV
PF01592         altelvkgktleeAlkitnkdiaeelgglpkekmhcsvlaeealkaavakYk------------------


                         +         -         -         -         -         *         -:210
query           HG--------------------------------------------------------------------
PF01592         ----------------------------------------------------------------------