[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81560.1


[Show Plain Result]

## Summary of Sequence Search
   1::219
   3::216  PF01168 0.0% 28.9473684210526  Alanine racemase, N-terminal domain 
  78::195  PF02784 0.0% 20  Pyridoxal-dependent decarboxylase, pyridoxal bindin 
   1::219


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDIKENLTKFTEKIPSNVQLIAVSKTRTIEEMEEAYEFGIRKFGENKVQEIIRKFDEFHQDVEWHLIGHL
PF01168         --lrhniaalreaa.ra.kllaVvKanayghgavrvakalaagadgfgvarlqEal..............
PF02784         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QTNKVKYIVDKVHLIQSLDSIKLLKEIEKVYGKHNKIANTLIQVNIGREEQKYGILEEELDELIEAIEAC
PF01168         ..elrsnkilvlegfepeelaalvey.dlvptvdsleqaealskaakeagrplrvhlkvdtgme..RlGv
PF02784         -------aleaqvvvvtvdneeeLekvaklapelelllRvkpdvdakahkklstgqedsKFGldlekeae


                         +         -         -         -         -         *         -:210
query           NNVNVLGIMTIIPKGTEEECRKYFSKTHKLFCELKEKKFKNIKMDILSMGMSGDYEIATEEGSNMVRIGQ
PF01168         epeeaeelaealaalpglrleGlmthfaladepdetereqfarfreladeleaaglkpl...vlslgnSa
PF02784         ellkaakele.lklvGvhfhvGSqisdleafvkAveearevfeelakelGve..e---------------


                         -         -         -         +         -         -         -:280
query           GIFGKRLYK-------------------------------------------------------------
PF01168         dlllai----------------------------------------------------------------
PF02784         ----------------------------------------------------------------------