[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81626.1


[Show Plain Result]

## Summary of Sequence Search
   1::116
   5::30   PF00515 0.0% 38.4615384615385  Tetratricopeptide repeat 
  37::66   PF00515 0.0% 50  Tetratricopeptide repeat 
  68::93   PF00515 0.0% 26.9230769230769  Tetratricopeptide repeat 
 101::109  PF00515 0.0% 44.4444444444444  Tetratricopeptide repeat 
   4::30   PF07719 0.0% 29.6296296296296  Tetratricopeptide repeat 
  36::66   PF07719 0.0% 48.3870967741936  Tetratricopeptide repeat 
  68::93   PF07719 0.0% 26.9230769230769  Tetratricopeptide repeat 
  12::28   PF04212 0.0% 35.2941176470588  MIT (microtubule interacting and transport) domain 
  49::64   PF04212 0.0% 50  MIT (microtubule interacting and transport) domain 
  84::108  PF04212 0.0% 37.5  MIT (microtubule interacting and transport) domain 
   5::27   PF08631 0.0% 47.8260869565217  Meiosis protein SPO22/ZIP4 like 
  34::64   PF08631 0.0% 25.8064516129032  Meiosis protein SPO22/ZIP4 like 
   1::116


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSNFSKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYF
PF00515         ----nlGnaylklgkydeAieyyekALeln------lynlGnaylklgkydeAieyyekALelnPn-kal
PF00515         ----nlGnaylklgkydeAieyyekALeln------lynlGnaylklgkydeAieyyekALelnPn-kal
PF00515         ----nlGnaylklgkydeAieyyekALeln------lynlGnaylklgkydeAieyyekALelnPn-kal
PF00515         ----nlGnaylklgkydeAieyyekALeln------lynlGnaylklgkydeAieyyekALelnPn-kal
PF07719         ---ynlGlayyklgdyeeAleafekAleld-----alynlGlayyklgdyeeAleafekAleldPn-eal
PF07719         ---ynlGlayyklgdyeeAleafekAleld-----alynlGlayyklgdyeeAleafekAleldPn-eal
PF07719         ---ynlGlayyklgdyeeAleafekAleld-----alynlGlayyklgdyeeAleafekAleldPn-eal
PF04212         -----------eagkyeeAlelYkeAle--------------------kyeeAlelYkeAlelL------
PF04212         -----------eagkyeeAlelYkeAle--------------------kyeeAlelYkeAlelL------
PF04212         -----------eagkyeeAlelYkeAle--------------------kyeeAlelYkeAlelL------
PF08631         ----nkakklyktknydealewyklal------arvlyniGkellerktdfseavkwlkraldl------
PF08631         ----nkakklyktknydealewyklal------arvlyniGkellerktdfseavkwlkraldl------


                         -         -         *         -         -         -         -:140
query           FNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKISK------------------------
PF00515         ynlGnaylklgkydeAieyyekA-------eyyekALel-------------------------------
PF00515         ynlGnaylklgkydeAieyyekA-------eyyekALel-------------------------------
PF00515         ynlGnaylklgkydeAieyyekA-------eyyekALel-------------------------------
PF00515         ynlGnaylklgkydeAieyyekA-------eyyekALel-------------------------------
PF07719         ynlGlayyklgdyeeAleafekA-----------------------------------------------
PF07719         ynlGlayyklgdyeeAleafekA-----------------------------------------------
PF07719         ynlGlayyklgdyeeAleafekA-----------------------------------------------
PF04212         -------------skAlelikkAveaDeag.kyeeAle--------------------------------
PF04212         -------------skAlelikkAveaDeag.kyeeAle--------------------------------
PF04212         -------------skAlelikkAveaDeag.kyeeAle--------------------------------
PF08631         ----------------------------------------------------------------------
PF08631         ----------------------------------------------------------------------