[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81632.1


[Show Plain Result]

## Summary of Sequence Search
   1::507
 389::497  PF02518 0.0% 28.9719626168224  Histidine kinase-, DNA gyrase B-, and HSP90-like AT 
 275::340  PF00512 0.0% 43.9393939393939  His Kinase A (phosphoacceptor) domain 
 183::248  PF00672 0.0% 25.7575757575758  HAMP domain 
   1::507


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKSISKRLFIITFGIIIFLTLFTMIFQITFFQEFYYKRKSNDLSNAVLKFRALYSYDIKNTDSLYRALS
PF02518         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LFELENNAKIGIYSIDSTPKYVPDPANKNSEAVDLLNDIFNELYSDQDFAKTLLNSNSGVTTEFKSRKYS
PF02518         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TKYIVYMVPFSLNSKNDSIIIAITSFQAIEEASALIKDFYKYIILIVIVIGLILSYVFSNLISKPLVKLN
PF02518         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF00672         ------------------------------------------vlllalllalvlawllarrilrPlrrLa


                         -         -         -         +         -         -         -:280
query           KSAKKMSAMDFSEKCDIEREDEIGNLAKTLNFLSKNLSNALDDLKIKNKKLEEDIEKERELEKLRKDFIA
PF02518         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------lgrfla
PF00672         eaarriaeGdlddrvpvdgrdEigeLarafnamlerLr--------------------------------


                         -         *         -         -         -         -         +:350
query           GASHELKTPIGIISGYAEGIKDGIVDHKDQGVYLDIIIDEAEKMNKLVMDMLELSKLEAGKIDLHIIDFS
PF02518         ----------------------------------------------------------------------
PF00512         gvsHELrtPLtailgnaellervgelteeelrealeiirdeaerlraliedlLdlsriea----------
PF00672         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LTELTEEVLVKNSVDINKNNLTVIKNYSPNEDLYVQGDDFKIEQVLTNFVTNAIKYSEPNNQIIIDIKPV
PF02518         --------------------------------------edrlrqivselvdNavkateesgeievrvkre
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           EEDKIYFSIENTGAHIPDSDINKIWTQFYRGDTSRNRGSRSTGLGLSIVKNLLQAHESEFGVMNTENGVK
PF02518         e.gelvieVeDnGiGipeedlervfepffqtdd.dsrkvggtGlGlsivkklvellggeieveskeggGt
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           FYFTLKKSKEIDEVEEI-----------------------------------------------------
PF02518         tvtlrlp---------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------