[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81731.1


[Show Plain Result]

## Summary of Sequence Search
   1::434
 147::318  PF04055 0.0% 33.9622641509434  Radical SAM superfamily 
   2::97   PF00919 0.0% 42.7083333333333  Uncharacterized protein family UPF0004 
   1::434


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQNPEA
PF04055         ----------------------------------------------------------------------
PF00919         -kvaletlGCqmNevdseelaallkkagyelvddaeeadvvlvnTCavrekAekkviqallelkalkkpe


                         -         -         *         -         -         -         -:140
query           IIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGAVLKNKVFEDLKIEEYNN
PF04055         ----------------------------------------------------------------------
PF00919         kkivvvGCmaerekeelakelpevdlv-------------------------------------------


                         +         -         -         -         -         *         -:210
query           KTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVT
PF04055         ------vvtrgCnlrCsfCanpetsregrgrsrsveeileevkelkeekgvkevtltGgeplly......
PF00919         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LVDLLEEIEKIDGIERVRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYE
PF04055         .pdfvellerlaklalpgirialetngtlpd.eeileelaelg..vdrvslglesgdeekvlklmrrght
PF00919         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           DIVNLLRDKIEDVSITTDVIVGFPGETDEEFEETYEFLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK
PF04055         feevlealeklreagikr...vvdfivglpgetdeele--------------------------------
PF00919         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI
PF04055         ----------------------------------------------------------------------
PF00919         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           NSFEGEVAEGEIVL--------------------------------------------------------
PF04055         ----------------------------------------------------------------------
PF00919         ----------------------------------------------------------------------