[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81831.1


[Show Plain Result]

## Summary of Sequence Search
   1::202
   6::174  PF01467 0.0% 35.6687898089172  Cytidylyltransferase 
   1::202


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKIGVFGGTFDPIHIGHIYIAYEAYKILELDEVIFMPAGNPPHKKWKDITDEIIRYEMVKKAIEPYSFF
PF01467         -----lagGtFDpiHlGHlrlleqakelldedlivvvpsdespkkdtkplfsaeeRvamlelalevderl


                         -         -         *         -         -         -         -:140
query           SINNYEIEKKGLSFTYETLRYLHESFKEVELYFITGADCLVNLNSWKNINEIFKFSNLVVFNRPGFDKND
PF01467         evddfelera............kkegpdvdlyliigadvleslekwraiqelleevklvvvsrpgddkle


                         +         -         -         -         -         *         -:210
query           LLKRKEEFDREYCTNIVYLDLLNIEISSTLIRERVRESLEVKFFLPPGVVDIIDKYNLYRRE--------
PF01467         tvldreeldkkplgiivikeppsndiSstkirer------------------------------------