[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81882.1


[Show Plain Result]

## Summary of Sequence Search
   1::378
  46::360  PF01979 0.0% 20.1388888888889  Amidohydrolase family 
  47::61   PF07969 0.0% 53.3333333333333  Amidohydrolase family 
 320::357  PF07969 0.0% 34.2105263157895  Amidohydrolase family 
   1::378


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHGAGGHDTMDGTYE
PF01979         ---------------------------------------------ivlPGlIDaHvHleqsllreedsye
PF07969         ----------------------------------------------vlPGFvDsHtHldgg---------
PF07969         ----------------------------------------------vlPGFvDsHtHldgg---------


                         -         -         *         -         -         -         -:140
query           AINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPD
PF01979         aiktgakealrsGtTtvldtp.tsantsvalrkeideglaaapklealvelllkgevggraelgevvidr
PF07969         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           FLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHA
PF01979         aageeeei....egadlikvieaggkgakaidgvlpalaphd.aqtvskeelkaevelaeeeeekeklgl
PF07969         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           THLFNAMTPFTHREPGVVGAVFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGM
PF01979         lvhihaaeasgekevvehlt..gkspverldhllllknaikggvtllahclhlddeairllkergsgvah
PF07969         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           YSLGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKE
PF01979         cplsnesvlhregrksllegdaqgigelgsggarlakvaeeagvk........lgtDgvaeelkvalllg
PF07969         ---------------------------------------erlsleealalyTrgpAkalgledrkGtlev
PF07969         ---------------------------------------erlsleealalyTrgpAkalgledrkGtlev


                         -         -         -         -         *         -         -:420
query           GYDADLILFDDNIDIKYVIVNGKLVHKA------------------------------------------
PF01979         ..........------------------------------------------------------------
PF07969         GkdADlv---------------------------------------------------------------
PF07969         GkdADlv---------------------------------------------------------------