[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81914.1


[Show Plain Result]

## Summary of Sequence Search
   1::535
   5::279  PF06418 0.0% 71.1678832116788  CTP synthase N-terminus 
 305::528  PF00117 0.0% 42.4731182795699  Glutamine amidotransferase class-I 
 366::512  PF07722 0.0% 24.3697478991597  Peptidase C26 
   1::535


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKNTKYVFVTGGVVSSLGKGITAASLGRLLKNRGLSVSIQKFDPYLNIDPGTMSPYQHGEVFVTDDGAE
PF06418         ----tkyifvtGGvvsslGkGitaaslgallksrglkvtllklDPYlnvdagtmsPyeHGEvfvtedgaE
PF00117         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TDLDLGHYERFIDENLTQNSNVTSGRVYWSVISKERKGEYLGGTVQVIPHITNAIKDRVHRVGKERDVDV
PF06418         tDldlGhYeRfldvkltkksnittgkiyseviekeRkGeylGktvqviPhvtdeikerikkvaee.eadv
PF00117         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VITEIGGTIGDIESLPFLEAIRQIKYDVGKENVCFIHVTLVPYLGKAGELKTKPTQHSVKELRSIGIQPD
PF06418         vivEiGGtvGdiEslpfleairqlklevgkenvllihvtlvpvlkaagelktkptqhsvkelrslGiqpd
PF00117         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           IIVCRSEKELSEDIKKKIGLFCNIDASEVIQNLDAEHLYAVPLMLHKEGLDRLVCEKLGLGCRDIDNAEW
PF06418         ilvcRsekeleeevkekialfcnvekeaviealdvesiyevpllleeqglaelvleklklekkeadlee-
PF00117         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IDMVHRITHLTHTTKIALVGKYVELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLSGVD
PF06418         ----------------------------------------------------------------------
PF00117         ------------------------liDnydsvtknlaralrelgvkvevvpndadaeeile..k.lknpd
PF07722         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GVLVPGGFGDRGVEGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVLGLEGAHSSELNPETPFPVIDL
PF06418         ----------------------------------------------------------------------
PF00117         gilisgGpgspgavegkieaikearenkiPiLGICLGmQllaiefggkvi....................
PF07722         ---------------elaLiraalergvPvlgiCrGlqllnvalggtlyqdikeepglsdhrehe.....


                         -         -         +         -         -         -         -:490
query           MPEQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYASDLIYERHRHRYEFNNEYRTQLIESGLTIAGTSPDG
PF06418         ----------------------------------------------------------------------
PF00117         ...kekkeehmggnmrlghdgk.......aallyglpnevivrhrHsyevnpk...ellpeglevtakse
PF07722         ........q........dasshavslekgsllarllgaeeievnslHhqaike......lakglevlAta


                         *         -         -         -         -         +         -:560
query           RLVECVEVKDHPWFVAVQYHPELKSRPNRPHPLFVGFVGAALNNK-------------------------
PF06418         ----------------------------------------------------------------------
PF00117         dggeimaivekkn.p.ivgvQFHPEssstpggpellfn--------------------------------
PF07722         edg.vieaieseeakyfvlgvQ------------------------------------------------