[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB81922.1


[Show Plain Result]

## Summary of Sequence Search
   1::78
   5::76   PF06257 0.0% 56.9444444444444  Protein of unknown function (DUF1021) 
   1::78


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSTRLTLNSIRKSIEDHVGEKVKLRANGGRKKILENEGILESVHPSIFVVRLQKDTQRKVTYSYSDVLTK
PF06257         ----kklkkIkekleahvGekvelkankGRkkvtereGiLeetYpsvFvveldeeensvervsYsYsDvL


                         -         -         *         -         -         -         -:140
query           TVQLDFVG--------------------------------------------------------------
PF06257         Tetvel----------------------------------------------------------------