[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB82028.1


[Show Plain Result]

## Summary of Sequence Search
   1::643
 275::442  PF00587 0.0% 31.0975609756098  tRNA synthetase class II core domain (G, H, P, S an 
 547::634  PF03129 0.0% 45.4545454545455  Anticodon binding domain 
 167::216  PF07973 0.0% 37.2093023255814  Threonyl and Alanyl tRNA synthetase second addition 
   2::61   PF02824 0.0% 23.3333333333333  TGS domain 
   1::643


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIKITLKDGSIKEVEAGLSIFEIAQSISQGLARNACCGILNGKVEDLRFIVNEDSSLEICTFDSKEGQHA
PF00587         ----------------------------------------------------------------------
PF03129         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------
PF02824         -irvytpdGkvpdlprgstveDfAykIhrslakkfiyAlVnGqrvglshvLedgDvVeIvt---------


                         -         -         *         -         -         -         -:140
query           FNHTASHVLAAAVKRLFPQDKLAIGPSIDNGFYYDFDTEKPFSADQLNKLEEEMKKIIKENPEIKRFELP
PF00587         ----------------------------------------------------------------------
PF03129         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RNEALELMKDEPYKVELINDLPEGEVISFYQIGDFVDLCAGPHLMAVKPIKAVKLLRSTGAYWKGDEKNK
PF00587         ----------------------------------------------------------------------
PF03129         ----------------------------------------------------------------------
PF07973         --------------------------vrvvsiGdvsvelCgGtHvpnTgeIgafkil.......seesia
PF02824         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           MLSRVYGTAFPKKSELDAYLEALEEAKKRDHNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIE
PF00587         ----------------------------------------------------------------iiqawr
PF03129         ----------------------------------------------------------------------
PF07973         kglrRI----------------------------------------------------------------
PF02824         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           DEEQRRGYVLTKTPLMAKSDLYKISGHWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYR
PF00587         eefieeegflevdtPiltpeevlkasGhvdkfademykvkdtge..eelyLrPetaqgiflnfkkllesn
PF03129         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITY
PF00587         yrklPfklaqigkvfRnEi.sprsGllRvReFtqaeieifvdpekseeeleellalikefleklgl.ekl
PF03129         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           RFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDTIITIQ
PF00587         rfrqstrgelahyakdtwdlev------------------------------------------------
PF03129         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           IDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAMLIEKYAGALPTWIAPVQAKVLPLSDKYADY
PF00587         ----------------------------------------------------------------------
PF03129         --------------------------------------------------------qvvviplgekaeel
PF07973         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           ANEVVEELRRRGVRVEADHRAEKIGYKIREARLERTPYILVVGEKEAENKEVSVRSRKNGEEGAMPLADF
PF00587         ----------------------------------------------------------------------
PF03129         edyakklaeeLreagirvelddrsesigkklrradllgipfavvvGekelekgtvtvrdrdtgekervsl
PF07973         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           VNRIVLEIANREN---------------------------------------------------------
PF00587         ----------------------------------------------------------------------
PF03129         eelv------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------